(data stored in ACNUC7421 zone)

EMBL: CP002116.PE191

CP002116.PE191       Location/Qualifiers
FT   CDS_pept        complement(198520..199368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0194"
FT                   /product="ABC-3 protein"
FT                   /note="COGs: COG1108 ABC-type Mn2+/Zn2+ transport systems
FT                   permease components; InterPro IPR001626; KEGG:
FT                   pca:Pcar_3024 ABC-type transport system, permease
FT                   component; PFAM: ABC-3 protein; SPTR: ABC-type transport
FT                   system, permease component; PFAM: ABC 3 transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79351"
FT                   /db_xref="GOA:E1R8K7"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8K7"
FT                   /protein_id="ADK79351.1"
FT                   /translation="MLNFFGQFFHDLVTFPFLRNALLACLFLAPAAGIIGTYVTVERIN
FT                   SMAGAVAHSVLAGLGAARFLQVSFGWSYPTPLQGAAVAAVIVALIIGGITGRGRERTET
FT                   VLAAIWAIGMAIGIFFIAATPGYSQDLMSYLFGNILMIRKSDTILLLVMDLVLILVILF
FT                   RYKEIFAVTFDGEFAALRGVKVRRIYYLMLLLTSLTIVLAVQLVGIVMVIALLTLPAAT
FT                   AGLFSHTLWKMMIFASLLSFLYTGGGLAISYSADKPAGATIILFAAAVYLGTMLVKRRT
FT                   R"
     gtgttgaatt tcttcggtca gttttttcac gaccttgtta cctttccttt tttgaggaac        60
     gccctccttg cctgcctctt tcttgcaccg gctgcaggga tcatcggtac ctacgtcacc       120
     gtggagagaa tcaattccat ggcaggagcc gtagcccatt cggttctcgc aggactgggg       180
     gccgcacgtt ttctccaggt gagcttcgga tggagctatc cgacaccgct ccagggcgct       240
     gctgtggcgg cagtcatcgt cgctctgatc ataggaggca tcacggggcg gggcagggaa       300
     cgaacggaaa cggttctggc cgcaatctgg gccatcggta tggcaatcgg tatctttttc       360
     atcgccgcaa cccctggtta ctctcaggat ctcatgagtt accttttcgg taatattctg       420
     atgatcagaa aaagcgacac cattctcctc ctggtcatgg atcttgtact gattctggtg       480
     attctatttc gctataagga gatattcgct gttaccttcg acggtgagtt tgcggcgctg       540
     cggggagtaa aggtacgtag gatctattat ctgatgcttc tgcttaccag ccttaccatc       600
     gtgctggccg ttcaactcgt gggtattgtc atggtcatag cgcttttgac ccttccggct       660
     gccactgcag gactcttttc ccacaccctt tggaagatga tgatctttgc gtcgctgttg       720
     agttttctct acacgggagg gggacttgcc atcagctact cggcggacaa accggcaggt       780
     gccaccatca ttcttttcgc cgcagcggtc tatctgggga caatgctggt caaacggaga       840
     acacggtaa                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page