(data stored in ACNUC7421 zone)

EMBL: CP002116.PE192

CP002116.PE192       Location/Qualifiers
FT   CDS_pept        complement(199362..200171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0195"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1121 ABC-type Mn/Zn transport systems
FT                   ATPase component; InterPro
FT                   IPR003593:IPR003439:IPR017871:IPR018184; KEGG:
FT                   pca:Pcar_3025 ABC-type transport system, ATP binding
FT                   component; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; SPTR: ABC transporter related; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79352"
FT                   /db_xref="GOA:E1RA61"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA61"
FT                   /protein_id="ADK79352.1"
FT                   /translation="MSDNEGRGAPSTEPLSVVNFEDVSFGYGEDRVLESVSFEILQGDF
FT                   AAIIGPNGGGKTTILKLILGLLIPDEGRIRLFDSPSEEARKRVGYVPQYTLFDPLFPAT
FT                   VEDVVLMGRLGAKSRLGFFRREDRRIAASALKTVGLEGLEKRPFPALSGGQRQRVLIAR
FT                   ALASEADLLILDEPTSNVDRTAEKEIYTLLGSLKGEKTILLVSHDTAVVSNLADTILCI
FT                   NRTLARHPGCELTGEDLGKLYGDDMKLVLHDIHNEASAASAKEDSTC"
     atgagtgata atgaaggaag aggggctccg tcgacggagc ccctgtctgt ggtaaatttc        60
     gaggatgtct cttttggcta cggtgaggat cgtgttcttg aatcggtctc ctttgaaatc       120
     cttcagggag actttgccgc aatcatcggg ccgaacggcg gcggaaaaac caccattctc       180
     aaacttatac tcggactcct cattcccgat gaaggtcgga tacggctgtt cgattcccct       240
     tcggaggagg cacgaaaacg ggtgggctat gttccccagt atacgctctt tgatccgctt       300
     ttccctgcaa cggtggagga tgtggttctg atgggacggc tgggagcaaa aagcaggctc       360
     ggcttctttc gccgggaaga tcgccgcatt gctgcctccg cactaaaaac ggttgggctt       420
     gaaggactcg aaaaacgtcc ctttccggcc ctttccggag gtcagcgcca acgggttctc       480
     attgcccgtg ccctggcaag cgaggcagat cttttgatcc tcgacgagcc aaccagcaat       540
     gtagacagaa cggcggaaaa ggaaatttat acccttcttg gttcattaaa gggagagaaa       600
     accatactcc tggtaagcca tgacaccgcc gtcgtttcca atctggctga tactatcctt       660
     tgcataaaca ggacccttgc cagacatcct ggctgcgaac tgacgggaga agatcttgga       720
     aaactctacg gtgacgatat gaaactggta ttacatgata tacacaatga agcttccgcc       780
     gcttcagcaa aggaggattc aacgtgttga                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page