(data stored in ACNUC7421 zone)

EMBL: CP002116.PE193

CP002116.PE193       Location/Qualifiers
FT   CDS_pept        complement(200171..201127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0196"
FT                   /product="periplasmic solute binding protein"
FT                   /note="COGs: COG0803 ABC-type metal ion transport system
FT                   periplasmic component/surface adhesin; InterPro IPR006127;
FT                   KEGG: dal:Dalk_1551 periplasmic solute binding protein;
FT                   PFAM: periplasmic solute binding protein; SPTR: Periplasmic
FT                   solute binding protein; PFAM: Periplasmic solute binding
FT                   protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79353"
FT                   /db_xref="GOA:E1RA62"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA62"
FT                   /protein_id="ADK79353.1"
FT                   /translation="MKRHKKRCSIVSALLFMLIASLPLMAGGNRESAPTSGDSEKPIVY
FT                   SSILPVQFLADRIGGDRITSEVVVLPGESPATYEPTPKQMSALAQASLLFRVGVPFENG
FT                   FLPKVRELSPDLTIIDLRKGLTLRTMDAAHSHDEEHDGDHEGEGEDGHDHEAGTPDPHI
FT                   WMSPRNMMIMAQTMADALAAADPDGAELYKDNLAGLESDLKTLDERLAQDLEPLRGKRF
FT                   FVYHPAFGYFADDYGLIQIPLEIEGKEPTPKQLVFYIEEAKELDVEIIFVQPEFPRQSA
FT                   QTVAKEIGGMVVPVSALAKEYIANLDTVASALEEGLR"
     atgaagcgtc acaaaaagag atgtagtatt gttagtgcac tgctttttat gcttatagca        60
     agccttccgc tcatggcagg aggcaatcgt gaatcggctc ccacatccgg ggatagcgaa       120
     aagccgatcg tctattcttc cattctgccg gtccagtttt tggccgatag aatcggcggc       180
     gatcgcatta catcagaggt agtggtactt cccggcgaaa gcccggctac ctacgaaccc       240
     acaccaaagc agatgagtgc tctcgcacag gcttcgcttc tctttcgggt cggggttccc       300
     tttgagaacg gctttttacc gaaggtaaga gagcttagtc ccgaccttac cattatagat       360
     cttcgaaaag ggctcaccct tagaaccatg gatgctgccc attcccacga tgaagaacat       420
     gatggggatc acgaaggtga gggggaagac ggccacgacc atgaggcagg aactcccgac       480
     cctcatatct ggatgagtcc ccgtaacatg atgatcatgg cacagaccat ggccgacgcc       540
     cttgctgcag cggatcccga cggagctgaa ctatacaagg ataaccttgc gggccttgaa       600
     tcggacttaa agaccctgga tgagcgactt gcgcaggatt tggaaccact acgcggaaag       660
     cgttttttcg tctaccatcc ggctttcggc tattttgccg acgactacgg cctgatacag       720
     attcccctgg aaatagaggg gaaagaacca accccaaaac agctggtctt ttatatcgag       780
     gaggcaaagg aacttgatgt ggaaatcatc tttgtgcagc ccgaatttcc ccgacagagc       840
     gcccaaaccg tggcaaaaga gatcggagga atggttgtgc cggtcagcgc cctggcaaag       900
     gagtatattg ccaacctcga caccgtggca tctgccctgg aggaaggcct ccgttga          957
//

If you have problems or comments...

PBIL Back to PBIL home page