(data stored in ACNUC7421 zone)

EMBL: CP002116.PE194

CP002116.PE194       Location/Qualifiers
FT   CDS_pept        complement(201102..201392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0197"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hmg:100209601 similar to Zinc finger protein
FT                   418; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79354"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA63"
FT                   /protein_id="ADK79354.1"
FT                   /translation="MAQQKEETITFKVDPALAELLRRVPNRSEFIRKALFAQLDNVCPL
FT                   CQGSGYLTPDQKNHWEKFSKHHHVVRCESCHEYYLSCDLKEDHHEASQKEM"
     atggcacaac aaaaggaaga gaccataacc ttcaaagttg acccggctct ggcggaacta        60
     ctccggaggg ttcccaatag atccgagttt ataagaaagg cgctctttgc ccagttggac       120
     aatgtctgtc cgctctgcca gggaagtggt tatctcaccc ctgatcaaaa gaatcattgg       180
     gaaaagtttt caaaacatca ccatgtggtg cgttgtgagt cgtgccacga atactatctt       240
     tcgtgcgatc tcaaggagga tcatcatgaa gcgtcacaaa aagagatgta g                291
//

If you have problems or comments...

PBIL Back to PBIL home page