(data stored in ACNUC7421 zone)

EMBL: CP002116.PE195

CP002116.PE195       Location/Qualifiers
FT   CDS_pept        complement(201481..202368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0198"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COGs: COG0583 Transcriptional regulator; InterPro
FT                   IPR000847:IPR005119:IPR017871; KEGG: ere:EUBREC_1090
FT                   transcriptional regulator, LysR family; PFAM: LysR
FT                   substrate-binding; regulatory protein LysR; SPTR:
FT                   Transcriptional regulator, LysR family; PFAM: LysR
FT                   substrate binding domain; Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79355"
FT                   /db_xref="GOA:E1RA64"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA64"
FT                   /protein_id="ADK79355.1"
FT                   /translation="MINPNFEYYKIFYYVGKHQNLTTAAHLLLTSQPSVSRSIKNLEHD
FT                   LSCRLFVRSKKGVTFTPEGALLYSHIASACESIFEGEKALSRALHLESGAVAIGTTEIA
FT                   IHCYLLEKLASFHKAHPKVTLTIINRSAPALIDEIKSGAIDIAVVTTPIEGEKNLTITK
FT                   VKKFRDILVAGPAFSHLGDRVLTIEELPTYPLITLSKETATYRFYSSLYASHEMTWKAD
FT                   IELATADLLIPFIKQNLGIGFVPHIMASPALASGEIRALTLSTDIPEREICIVQDKRHP
FT                   LSAASRQLIHWLAP"
     ttgatcaatc cgaatttcga atattacaag atcttctatt atgtgggtaa acatcagaat        60
     ctcacaaccg cagcccatct ccttttgacc agtcaacctt ccgtaagccg aagcatcaag       120
     aatctggaac acgatctatc gtgccgtctc tttgttcgtt cgaaaaaagg ggttaccttt       180
     actccggagg gggcactact ctacagccat atagcttctg cctgtgaatc gatatttgaa       240
     ggagaaaaag ctctgtcaag ggccttacat ctggaaagcg gcgcagttgc catcggaacc       300
     acggaaatcg ctatccactg ttatctactg gaaaaactgg catcctttca caaggctcat       360
     cccaaggtta ctcttactat catcaaccgc agtgctcctg cacttatcga tgaaatcaaa       420
     tcgggagcaa tcgatattgc ggtggtaaca actcccatcg aaggcgaaaa aaatctaacc       480
     attaccaagg taaaaaaatt tcgggatatt cttgtggccg gacctgcgtt ttcccatttg       540
     ggagaccgag ttcttaccat tgaggaatta ccgacatacc cattaatcac gctttcgaaa       600
     gaaaccgcaa catatcgttt ttactcctcc ctctatgcct cgcatgaaat gacatggaag       660
     gccgatattg aacttgcaac agcggacttg ctgatccctt ttatcaaaca gaatctgggg       720
     ataggtttcg taccccacat aatggcatct cccgcacttg cctcaggtga gattcgcgcg       780
     cttacccttt caaccgatat acctgaacgg gaaatctgta ttgtacaaga caaacgccat       840
     ccgctaagtg cggcaagtcg gcaactcatt cactggctgg ctccgtaa                    888
//

If you have problems or comments...

PBIL Back to PBIL home page