(data stored in ACNUC7421 zone)

EMBL: CP002116.PE196

CP002116.PE196       Location/Qualifiers
FT   CDS_pept        202501..202911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0199"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ccu:Ccur_10090 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79356"
FT                   /db_xref="GOA:E1RA65"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA65"
FT                   /protein_id="ADK79356.1"
FT                   /translation="MLDLLEALMILCFGLSWPISIYRSYVSRTAKGKSLFFEVFLWIGY
FT                   VFGISRKILQWYGSDSASLNFLFYLGWFFYILNIVEITIDMGLYFRNVKLDREREAEPG
FT                   IERAEEVIEESNEIIEQMKELERGLDGKAKGK"
     atgcttgatt tactggaagc cttgatgatt ttatgttttg gtctttcctg gcccatttcg        60
     atttaccgtt cctatgtttc ccggacggca aaagggaaaa gtctcttttt cgaagtattt       120
     ttgtggattg gatatgtctt tggtatttcc aggaagattc tccaatggta tggaagtgat       180
     tccgcatccc taaattttct tttctatctt gggtggtttt tctacatcct gaacattgtg       240
     gagattacca tagacatggg cctctatttt cgcaacgtca aactcgatcg tgaacgtgag       300
     gctgagcctg ggatagagag ggccgaagag gttattgaag aaagcaacga aattatcgaa       360
     cagatgaaag agcttgagag aggacttgat gggaaggcga aagggaaata g                411
//

If you have problems or comments...

PBIL Back to PBIL home page