(data stored in ACNUC7421 zone)

EMBL: CP002116.PE198

CP002116.PE198       Location/Qualifiers
FT   CDS_pept        204099..205157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0201"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="COGs: COG0329 Dihydrodipicolinate
FT                   synthase/N-acetylneuraminate lyase; InterPro
FT                   IPR002220:IPR002136; KEGG: rba:RB7999 hypothetical protein;
FT                   PFAM: dihydrodipicolinate synthetase; ribosomal protein
FT                   L4/L1e; SPTR: Putative uncharacterized protein; PFAM:
FT                   Dihydrodipicolinate synthetase family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79358"
FT                   /db_xref="GOA:E1RA67"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA67"
FT                   /protein_id="ADK79358.1"
FT                   /translation="MNMKEIRRLLFQGMAIPAIPLALHEDGTFDPLHQRALLRYYIDSG
FT                   VGGIAAAVHTTQFEIRERPDFFRDFLTFVSGEISSYAAKKGRQILKIGGVCGNTKAAVS
FT                   EAGLLREKGFDLGLLSLATFKGKSPDSILEHCRKVAKEIPLFGFYLQPAVGGIPLSRDF
FT                   WKDFASIPNVLGIKVAPFNRYKTLDVVQGVSEAGRGHEVALYTGNDDSIIFDLLSSYPC
FT                   SGEEGRALRFSGGLLGHWCVWTSKAVELLEEIKKLRAKGSDIPFELLERAQKITDANAA
FT                   IFDAQNDFAGVIPGVHEILRRQGLLESRRCLDPSLELSPSQMGEIERVIGAYPELQDDA
FT                   FISLHIDQWLTN"
     atgaatatga aagaaattcg tcgtctgctc ttccagggaa tggcaattcc ggcaattccc        60
     cttgccttgc atgaagatgg tacatttgat cccttgcatc aacgcgccct gctccgctac       120
     tacatcgatt ccggggtagg aggaattgcg gctgcagtcc ataccacgca gtttgaaatt       180
     cgagaacggc ctgacttttt tagggacttc ctcaccttcg tttccgggga aatctcttct       240
     tacgctgcaa aaaaaggacg gcaaatacta aaaatcggtg gtgtttgtgg gaatacgaag       300
     gctgctgttt cggaggccgg acttctcaga gaaaaaggct tcgatcttgg acttcttagt       360
     cttgcgacat tcaagggaaa gagccccgac agcatccttg aacattgcag aaaggttgca       420
     aaagagatcc ctttgttcgg attttatctg cagcctgcgg ttggcggcat tcccctgtct       480
     cgcgatttct ggaaagactt tgcgtcgatt cccaatgtgc ttggcattaa ggtggcgccc       540
     ttcaaccgat ataaaaccct cgatgtcgtt cagggggtct cggaggcagg gcgcggccat       600
     gaggtcgctt tgtacacggg aaacgatgat agcattattt tcgatctgct ttcatcctac       660
     ccgtgttcag gggaagaggg gagagcgcta cgcttttccg gtggtctgtt gggacactgg       720
     tgtgtctgga ccagcaaggc ggtggaacta cttgaggaga tcaagaagct tagggcaaaa       780
     ggatcggata tcccttttga gctgctggaa cgggctcaaa agattaccga tgcaaatgcc       840
     gcgattttcg atgcacagaa cgatttcgcc ggggtaatcc caggggtcca cgagatcctt       900
     cgccggcagg gacttcttga atcgagacgt tgtcttgatc cttctttgga actatcacca       960
     tcccagatgg gagagatcga aagggtgatt ggtgcatatc ctgaacttca ggatgatgcg      1020
     tttatatcgt tacatattga ccaatggcta acaaactaa                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page