(data stored in ACNUC7421 zone)

EMBL: CP002116.PE199

CP002116.PE199       Location/Qualifiers
FT   CDS_pept        205170..206381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0202"
FT                   /product="natural resistance-associated macrophage protein"
FT                   /note="COGs: COG1914 Mn2+ and Fe2+ transporter of the NRAMP
FT                   family; InterPro IPR001046; KEGG: phe:Phep_1689 natural
FT                   resistance-associated macrophage protein; PFAM: natural
FT                   resistance-associated macrophage protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Natural
FT                   resistance-associated macrophage protein; TIGRFAM: NRAMP
FT                   (natural resistance-associated macrophage protein) metal
FT                   ion transporters"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79359"
FT                   /db_xref="GOA:E1RA68"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA68"
FT                   /protein_id="ADK79359.1"
FT                   /translation="MDKKGKGISQLAFLLGPGVITAATVLGPGSITVSSKSGALMEYSV
FT                   LWAVVIAGIFMATFTRMAARIGCLNDDSLLNIVRTKQHPVLAVVVGLSVFLIAGGFQTG
FT                   NNIGVGLAMDAMFGGGIMLWAPVFTIIALLFIWISRDFYKLLEKVMMTLVVIMIVAFIA
FT                   NVFMAGPSVGKIALGLVPSQPKIWGLVIAISATSFSIAAAAYQAYLVQGKGWSAAFLKK
FT                   AQRDATIGIVILCGLAALIMITSAAVLAPRGIGVKSAVDMAIQLEPLLGPLAKWLFLFG
FT                   LLAASFSSFISNAVLGGMFLSDGFGLGKSLNDISVKVFTTVLLLFSTTLAVILKTNPIE
FT                   VLVVAQASTILGGPLVAIVLLLLGNNKDVLQEHTNKPVTNVIAVLAILWISYLSYNQLM
FT                   AFIG"
     atggataaaa agggaaaagg gatatcacaa ttggccttcc tgcttggtcc gggggtgata        60
     acagctgcca cggtccttgg cccgggaagc atcacggtaa gcagcaaatc cggcgcgctg       120
     atggaatata gcgtgctttg ggcggtcgtc atcgcaggaa ttttcatggc gacatttacc       180
     agaatggctg caaggatcgg ttgtctgaat gatgattcac tcttaaacat cgtcaggaca       240
     aaacagcatc ctgttctggc agtcgtggtc ggtttgagtg tgtttcttat tgcggggggc       300
     ttccagacag ggaacaatat cggtgtcggc cttgcaatgg atgcaatgtt cggtggtggt       360
     atcatgctgt gggcaccggt ttttaccatt attgctcttc tctttatttg gatatcgcgg       420
     gatttttaca agctgctcga aaaggtgatg atgaccttgg ttgtgattat gattgtcgcc       480
     ttcatagcga acgtctttat ggctggtccc agtgttggaa agatagcctt agggcttgtt       540
     ccttctcagc ctaaaatatg gggcctcgtc attgccatct ccgcaacaag ttttagcatt       600
     gcagctgccg catatcaggc ctacctggta cagggaaagg gatggagtgc tgcgtttcta       660
     aaaaaagcac agcgagatgc gaccatagga atcgtcattt tgtgtggtct ggcggccctt       720
     atcatgatta catcggcggc ggttcttgca ccgcggggta tcggggtcaa gagcgccgtt       780
     gacatggcaa tccagcttga gcctctgttg gggcctttgg caaaatggct tttcctcttt       840
     ggccttttgg cagcctcctt ttcttccttt atctcgaatg ccgttctcgg cggtatgttt       900
     ctctccgacg gcttcggcct tggtaaaagc ctcaacgaca tctccgtgaa ggtatttaca       960
     acggtacttc tgcttttcag caccaccctt gccgtgatac tgaagacgaa ccccatagag      1020
     gtgctcgtgg ttgcccaggc ctcgacaatt ctgggagggc cgttggttgc catcgtgctc      1080
     ctgcttcttg gaaacaacaa agatgtgttg caggagcata ccaacaagcc tgttaccaat      1140
     gtcatcgccg tgttggcgat cctctggata agttatctct cctataacca attgatggcc      1200
     ttcattggtt ga                                                          1212
//

If you have problems or comments...

PBIL Back to PBIL home page