(data stored in ACNUC7421 zone)

EMBL: CP002116.PE2

CP002116.PE2         Location/Qualifiers
FT   CDS_pept        1565..1741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79162"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6N0"
FT                   /protein_id="ADK79162.1"
FT                   /translation="MKRWYNYEEDMCMNTEGCGYVHFHGITFTSYSDGQLFLSKEIMAD
FT                   INIFTVPIITTIN"
     atgaaaagat ggtacaacta tgaggaagat atgtgcatga ataccgaagg ctgtggatat        60
     gtgcattttc atggaataac ctttacaagt tattcagatg ggcaactatt tctttcaaaa       120
     gaaattatgg cggatattaa catattcacc gtgcctatta ttactactat taattaa          177
//

If you have problems or comments...

PBIL Back to PBIL home page