(data stored in ACNUC7421 zone)

EMBL: CP002116.PE200

CP002116.PE200       Location/Qualifiers
FT   CDS_pept        206388..207074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0203"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="COGs: COG1309 Transcriptional regulator; InterPro
FT                   IPR001647; KEGG: reu:Reut_A1048 TetR family transcriptional
FT                   regulator; PFAM: regulatory protein TetR; SPTR: Putative
FT                   uncharacterized protein; PFAM: Bacterial regulatory
FT                   proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79360"
FT                   /db_xref="GOA:E1RA69"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041474"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA69"
FT                   /protein_id="ADK79360.1"
FT                   /translation="MLSGLASKEQYVPVLLFLPMLKFESDGIVMQKRSRDTKERIFKAA
FT                   VEEFAKSGFHGARVDNIAKKAKSNKERIYAYFGSKEDLFIEVWKRTYMLIIEVDEQFMD
FT                   LTDEDIPSLTGIILKRYVHFHQEHSEFWKIFVWENMLDGKHTEKVKGFKERPYKHLRRL
FT                   YARGQELGFFSREVSFETYMFVITAVSFFYASNRCTMSQSLSINLTNNDVVEGMIEEAT
FT                   KMLNGK"
     atgctgtcgg gattagcatc taaagagcaa tacgtaccgg tattgctctt tcttccaatg        60
     ctaaaatttg aatccgatgg gattgtcatg caaaaacgga gcagggacac aaaggaacgt       120
     attttcaagg ccgcggtaga ggaatttgcc aagtcggggt ttcacggtgc acgtgtagat       180
     aatattgcga aaaaggctaa gagcaataag gaacgcatct atgcctattt cggcagcaaa       240
     gaagaccttt tcatcgaggt atggaagcgt acctatatgc ttattatcga ggttgatgaa       300
     cagtttatgg acctaaccga tgaggatatc ccatccctca ccggaatcat attgaaacgg       360
     tatgtgcatt tccatcagga acattcggaa ttctggaaga tcttcgtgtg ggaaaatatg       420
     cttgatggaa aacatacgga aaaggtaaag ggattcaaag aaaggcctta taaacatttg       480
     cgtagactct atgcaagggg gcaggagctg ggattcttct cccgtgaggt ctctttcgag       540
     acctatatgt tcgtcatcac tgccgtttcg tttttctatg cttcgaatag gtgcaccatg       600
     agccagtccc tctcgataaa cctcaccaac aatgatgttg ttgaggggat gattgaagaa       660
     gcaacaaaga tgcttaatgg aaaatga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page