(data stored in ACNUC7421 zone)

EMBL: CP002116.PE201

CP002116.PE201       Location/Qualifiers
FT   CDS_pept        207078..208277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0204"
FT                   /product="acetylornithine deacetylase (ArgE)"
FT                   /note="COGs: COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylase; InterPro
FT                   IPR010169:IPR002933:IPR011650:IPR001261; KEGG:
FT                   bid:Bind_1040 acetylornithine deacetylase (ArgE); PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein; SPTR:
FT                   Acetylornithine deacetylase (ArgE); TIGRFAM:
FT                   acetylornithine deacetylase (ArgE); PFAM: Peptidase family
FT                   M20/M25/M40; Peptidase dimerisation domain; TIGRFAM:
FT                   acetylornithine deacetylase (ArgE)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79361"
FT                   /db_xref="GOA:E1RA70"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA70"
FT                   /protein_id="ADK79361.1"
FT                   /translation="MIMEQQLEKISQEAVRILSDLVSFRSVSGSDNEDIITYIADYLIS
FT                   YGLSPKRISAGRSHSNNLFVTIGESRDGGVLLSGHTDIVPASGAGWDSDPFVLSPRQVC
FT                   GEEMLYGRGACDMKGFLAAILALVPRWIEKRLGCNKEPIHLAFTYDEEIGCIGVDDLIA
FT                   ELGSCLPRPDAVLVGEPTLLRPADGHKSASRYITTVKGVSTHSSRPASGVNAIYGANHL
FT                   IAELQRFAGEIQSRSSRDPEARRFDPPYSTISLGTIHGGTAINVVAEQCELGWEARALP
FT                   WEDPQQYLRHIEDFSRHLSETLPDGKKLVFTHRLDSFLPGLSPKASKAYGYYQAMMVAG
FT                   NKIPQPTTTVAFGTEAGKYDQAGIPALIWGPGSIDRAHGKNEYIEKQQLVDCCALLSKL
FT                   "
     atgatcatgg aacaacaatt ggaaaagatc tcccaggagg cggtgcgcat tctgtcggat        60
     cttgtttcct tcagaagtgt aagcggttcg gataatgagg atatcatcac atacattgcc       120
     gattacctta tctcatacgg attatccccc aagcggatct ccgccggtcg ttcgcacagt       180
     aataatcttt tcgtaaccat aggggaaagc cgggatggtg gagtgctgct ttccgggcac       240
     accgatattg tccccgcatc tggcgcaggc tgggattcgg atccctttgt actgagcccc       300
     cgccaggtgt gtggggaaga gatgctgtat ggacggggtg cctgcgatat gaagggcttt       360
     cttgccgcta ttctcgcgtt ggttccacgc tggatcgaaa aacgattggg ctgcaataag       420
     gagccgattc atcttgcctt tacctatgat gaggagatcg gatgcattgg cgtcgacgat       480
     cttatcgccg aattaggttc gtgcctcccc cgtccagatg cggtgcttgt tggagagcct       540
     accttgctgc ggcccgcaga cggacataaa agcgcatcac gctatatcac cacggttaaa       600
     ggtgtatcca cccactccag tcgtcctgcc tccggggtaa acgccatcta tggggcaaat       660
     catcttattg ccgaacttca aagattcgcc ggggagatac aaagccggag ttcccgggat       720
     ccggaagccc ggcgtttcga tcccccctat tcaaccattt cccttgggac cattcatggg       780
     ggaacggcaa tcaacgtcgt ggcagagcag tgtgaattgg ggtgggaggc acgggccctt       840
     ccctgggagg atcctcagca atacctgcga cacattgaag acttttcccg ccacctgtca       900
     gagacactcc ctgacggaaa gaaattggtg tttacccatc ggctcgactc ctttcttccc       960
     gggcttagcc cgaaggcctc taaggcatat ggctattatc aagccatgat ggtcgcaggt      1020
     aacaaaatcc cccaacctac tacaaccgtc gcgtttggta ccgaggcggg gaagtatgac      1080
     caggccggga ttcccgcctt gatctgggga ccggggtcga ttgacagggc ccacgggaag      1140
     aatgaataca tcgagaaaca acaacttgtt gactgctgtg ctctgctgtc gaagctctga      1200
//

If you have problems or comments...

PBIL Back to PBIL home page