(data stored in ACNUC7421 zone)

EMBL: CP002116.PE202

CP002116.PE202       Location/Qualifiers
FT   CDS_pept        208342..209445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0205"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_7828 peptidase M14, carboxypeptidase
FT                   A; SPTR: Glycoprotein B"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79362"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA71"
FT                   /protein_id="ADK79362.1"
FT                   /translation="MEKKSRIILLIGLGLFLCLCSPLFADPGLEALYKEHFDTLVTSVY
FT                   PLFDVRFFPSGALEDSFSPLEEQRAQELFSVLDDYLDKDEDPHPYLIDARDYGTKAFAE
FT                   GAFSIGTYAAGDDFPSLFPVIEPKFTPDGNDAMIRLALSKRAFDEEGVATAVAVAQFAN
FT                   LLKQFYDANHNSIVQFINGRNLSEEFLYMRDALMVQDSVIEFYLDASDKTLEGAEFFLA
FT                   DSFFRDQMDSVMMLGYGIDQRMMKFLDTRYQVLLSQQENFESFIDGFDQMIQGAEDNAP
FT                   DPEQGSEFDLLIYRNRVATMWIFQGWYLALLPGRFPVYDAPEPIKMKLSALLRRWEGME
FT                   DDILASEAMLTQKRTEFVARIMEPADG"
     atggaaaaga aaagcagaat catcttgttg attgggttgg gacttttttt gtgtctttgc        60
     tcacctcttt ttgccgatcc cggactggag gccctgtaca aggaacattt cgataccctt       120
     gttacttccg tctaccctct ttttgatgtg agattctttc cttctggtgc gttggaggat       180
     tctttttcgc ctttagagga gcaacgggct caagaacttt tttcggttct ggacgactac       240
     ctcgataaag acgaggatcc ccatccctat ctgatagacg cccgcgatta cggtacgaaa       300
     gcctttgctg aaggggcttt ttcaattggt acctatgctg ccggggatga tttcccatcg       360
     ctttttcccg tcattgagcc gaaattcacc cctgatggca atgatgccat gattcgcctt       420
     gccctctcga agcgggcatt cgatgaggaa ggcgtagcga ccgctgttgc cgtcgcacag       480
     tttgcaaatc ttttgaagca attctacgac gccaaccaca atagcatcgt ccagtttatt       540
     aacggaagaa acctttccga ggagtttctt tacatgcgtg acgccttgat ggtgcaggat       600
     tctgtcatcg aattttacct tgatgcttcg gataaaaccc tggagggcgc cgaatttttt       660
     ctcgccgatt ccttttttcg ggatcagatg gacagcgtca tgatgctcgg ctacggtatt       720
     gatcagcgga tgatgaaatt ccttgatacc cgttaccagg tcctgctttc ccaacaggaa       780
     aactttgaat cgtttatcga cggttttgac cagatgatac agggggccga ggacaatgct       840
     ccggaccccg aacaaggtag tgagtttgat cttttgatct accgaaacag ggtggcaacc       900
     atgtggatct ttcaggggtg gtatcttgcc ctgcttcccg gtcgtttccc cgtctatgac       960
     gccccggaac caatcaagat gaagctgtct gcgcttttgc gccgctggga ggggatggag      1020
     gatgatatcc ttgcttccga agcgatgttg acccagaagc gtaccgagtt tgtcgccagg      1080
     atcatggagc ctgccgatgg ttga                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page