(data stored in ACNUC7421 zone)

EMBL: CP002116.PE203

CP002116.PE203       Location/Qualifiers
FT   CDS_pept        209438..211105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0206"
FT                   /product="Ankyrin"
FT                   /note="InterPro IPR002110:IPR020683; KEGG: afv:AFLA_025240
FT                   ankyrin repeat-containing protein, putative; PFAM: Ankyrin;
FT                   SMART: Ankyrin; SPTR: Ankyrin repeat-containing protein,
FT                   putative; PFAM: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79363"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA72"
FT                   /protein_id="ADK79363.1"
FT                   /translation="MVELQRGAAVALLLLCFSGWGFSLPEDHRPSLLSMEELSQAALQV
FT                   HDRYEIPYPPLADITLLYDGARVRAWIEACNEGKAQPMPRRWFTGTGTGFSSMIYMSCV
FT                   SFLTGKGWALAESAFEKRLGNDSVNERNRAILNAFLAIDNQEEMKEAAPRFFPFSMFLK
FT                   RRELGDGVSIMLPDVAWKLLPSGSTPLARTLVYGDEGFLRGLGYDRKRVGPGYDIRRDP
FT                   IAMASCIKVRMEKAINGNGTYLPLRPGMPFAIAKKVAVGDFFADTIWFQPFISAPDGVE
FT                   TGAEGRLYFKQGNQLFVVSLFSMVDSSHPAADGDLLLGEAASLLSTLQFPAEDTLLDSH
FT                   RLAALSDLLHAGDVSLLRPELQTIVRETGSIHFPDSHGEPFWHKIFLDFDRDDPRREAL
FT                   LKLFISLGINPDASGPSGKRAVDYVVEQGDAGLLEDVLLARAHGDYLTKDGSSPLIEAA
FT                   SGGDVWCVLTLLRAGVNVDLPDIRGRSALHWAARHDYLAVAKLLLEKGASPESRDIAGK
FT                   SPLDLSPAFQDMRRSPLFVMVQKFCGSPTWAKVQPEEQ"
     atggttgagc tgcaaagagg ggctgccgtg gcgctccttc ttctttgctt ttccggctgg        60
     ggcttttcgc ttcccgagga tcatcgtccc tctctcttgt cgatggagga actctcccaa       120
     gcagcattac aggtgcatga tcgctatgag attccctacc ctccccttgc cgacataacc       180
     cttctgtacg atggggcccg tgtccgcgcc tggattgagg cctgtaatga aggaaaggcc       240
     cagcccatgc cgcgtcgctg gtttaccggg acgggaaccg gattctcctc aatgatctat       300
     atgtcgtgtg tctcctttct cactgggaag gggtgggcac ttgccgaatc cgcctttgaa       360
     aaaaggttgg gcaatgattc tgttaacgaa agaaataggg cgatcctaaa cgcctttctt       420
     gcgattgaca accaggaaga aatgaaagag gcggcgcctc gcttttttcc cttttctatg       480
     tttctgaaac gccgtgaatt gggtgacggt gtttcgatta tgctgcccga tgttgcctgg       540
     aagctcctgc cttcaggatc gacccccttg gctcggacct tggtatatgg ggatgaggga       600
     tttcttcggg ggctaggata tgatcgaaaa cgggtcggtc cgggctatga tattcgccgg       660
     gatccgattg ccatggcaag ctgtatcaag gtccgtatgg agaaggcgat caatggcaac       720
     ggtacctatc tccctctgcg accgggaatg ccgtttgcca ttgcaaaaaa ggtcgccgtg       780
     ggagatttct ttgccgatac catctggttt cagcccttta tctctgctcc cgatggtgta       840
     gagaccggtg cagaagggcg gctttatttc aaacagggga atcagctctt cgttgtatcg       900
     cttttttcca tggttgattc ctctcatccc gcagcagatg gggacctcct gttgggcgaa       960
     gcggcttcgc tcctttccac gctacaattt ccagcggagg atactctttt ggactcccat      1020
     cgtttggcag ctctttctga tttgctccat gctggagatg tatcgctatt acgaccggaa      1080
     cttcaaacta tcgtaagaga gaccggtagc attcacttcc ccgactccca tggcgaaccc      1140
     ttttggcata agattttcct cgatttcgat cgggatgatc cgcggcggga agcgctattg      1200
     aagcttttta tttctcttgg gataaatccc gatgcctctg gtccttcggg aaaacgggct      1260
     gtcgactatg ttgttgagca gggggatgct ggactgctgg aggatgtact gcttgcacgg      1320
     gctcatgggg attacctgac caaggatggt tcctctccat taattgaggc cgcttcaggt      1380
     ggtgatgttt ggtgtgttct taccctgctt cgggccggag tgaatgtgga tttgccggat      1440
     atacggggaa ggagtgccct tcattgggcg gcacggcatg attaccttgc tgttgcgaaa      1500
     ttgctgttgg aaaagggggc ttctcccgaa agccgggata ttgcaggcaa gagtcctctc      1560
     gacctctctc ctgcctttca ggatatgagg cgttcgccct tgtttgttat ggtccagaag      1620
     ttttgcggca gtccgacatg ggcaaaggta cagcccgagg agcagtga                   1668
//

If you have problems or comments...

PBIL Back to PBIL home page