(data stored in ACNUC7421 zone)

EMBL: CP002116.PE204

CP002116.PE204       Location/Qualifiers
FT   CDS_pept        complement(211015..211278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0207"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cac:CAC1032 transcriptional regulator; SPTR:
FT                   Putative transcriptional regulator, AsnC family; PFAM: FeoC
FT                   like transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79364"
FT                   /db_xref="InterPro:IPR015102"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA73"
FT                   /protein_id="ADK79364.1"
FT                   /translation="MQYRSILQQIKEEGRVDKASIAEKQETTVAMIEMLLTELERLGYL
FT                   QRDALARCSGACTHCSSGCTFAHVGLPQNFWTITNKGERLIS"
     atgcaatatc gctccatatt acaacagatt aaagaagagg gaagggttga taaagcatcc        60
     atcgccgaaa agcaagaaac tacggtggca atgatcgaaa tgctcctcac tgaattggaa       120
     cgactcgggt acttgcaacg cgacgccctt gcccgctgca gcggagcctg tactcactgc       180
     tcctcgggct gtacctttgc ccatgtcgga ctgccgcaaa acttctggac cataacaaac       240
     aagggcgaac gcctcatatc ctga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page