(data stored in ACNUC7421 zone)

EMBL: CP002116.PE205

CP002116.PE205       Location/Qualifiers
FT   CDS_pept        211335..211826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0208"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="InterPro IPR005358:IPR017969; KEGG: sga:GALLO_0915
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   UPF0153; SPTR: Putative uncharacterized protein; PFAM:
FT                   Uncharacterised protein family (UPF0153)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79365"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA74"
FT                   /protein_id="ADK79365.1"
FT                   /translation="MDPEYRILIQTAESRGRLYRDLVRKLRRVAPKELAAVMQELHDEA
FT                   FRRIDCLKCAHCCAVVGPRLTDTDIQRLGKALSMKPSAFEDTYLIRDEDGDLVFREHPC
FT                   PFLLADNRCLLYDRRPKACREYPHTDDKHARGLLKISLVNTRFCPIVALVFQGLEERYG
FT                   "
     atggatcctg aataccgtat cttgatccaa acggcggaaa gtcgtggtcg tctttatcgg        60
     gaccttgtac ggaaactgcg gcgcgtggca ccgaaagaat tggcggcggt tatgcaggaa       120
     cttcacgatg aagctttccg gcgcatcgac tgccttaagt gtgcacattg ctgtgccgta       180
     gttggtccgc gacttactga taccgatata cagcggttgg gaaaagcgct ttccatgaag       240
     ccttcggcat ttgaagatac atatcttatc agggacgagg atggggatct tgtatttcgt       300
     gaacatccct gcccgttttt gctggcggat aatcgttgtc tcctttacga tcggcggcca       360
     aaggcgtgca gggagtatcc gcataccgac gacaaacacg ccaggggttt actcaaaatt       420
     tctctcgtaa acacacgctt ctgcccaatt gttgcattgg tgtttcaggg actggaggag       480
     cgctacggtt ag                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page