(data stored in ACNUC7421 zone)

EMBL: CP002116.PE206

CP002116.PE206       Location/Qualifiers
FT   CDS_pept        complement(211823..212923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0209"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="COGs: COG2114 Adenylate cyclase family 3 (some
FT                   protein contain HAMP domain); InterPro IPR001054:IPR018370;
FT                   KEGG: amc:MADE_00483 adenylate cyclase; PFAM: adenylyl
FT                   cyclase class-3/4/guanylyl cyclase; SMART: adenylyl cyclase
FT                   class-3/4/guanylyl cyclase; SPTR: Adenylate cyclase; PFAM:
FT                   Adenylate and Guanylate cyclase catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79366"
FT                   /db_xref="GOA:E1RA75"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA75"
FT                   /protein_id="ADK79366.1"
FT                   /translation="MEGTILIVSNLPIDTTKIRRYLAEHKIGDFDVVKVETEAAAEEIF
FT                   YGGGGVDCIVAQSEMTGTVALLKEMKQDEMFRHVPILLIIKGNETKLINEVYDSGFDAH
FT                   IVYTDIHCLPQRIRPLIVMNVMYRNMMKQVGDLHEKAISDFILLDLIKNYIPKTIWDIA
FT                   KTFAHEQKISIPEEELDLTIVFADIKGFTAMTQHMEPRQVVSILNTVFEVAAKHIYQNH
FT                   GDIDKYIGDAFFAVFTKAKEAVTAMTAMQDELEQINLQRKNQEHSPVEFRVGIHSGPII
FT                   RGNVGGHDRYDNTLIGDTVNTASRLEHIAPAGGIVISEETRTRIGITLPESCKSETELR
FT                   GRDSKITVYNAFSFLRSKLLAPQDKS"
     atggaaggta cgattcttat tgtttccaac ttaccaattg ataccacaaa aatcagaaga        60
     tatcttgcag aacataagat tggtgatttt gatgtggtaa aggtagaaac agaagccgcc       120
     gcagaagaga tattctatgg cggcggcggg gtcgattgta tcgttgcaca gtcggagatg       180
     acaggaaccg tcgccctgtt gaaagagatg aagcaggatg agatgtttcg tcatgtccct       240
     attctcctca tcatcaaagg aaatgaaaca aagcttatca atgaggtgta cgacagtggt       300
     ttcgatgcac atatcgtcta caccgatata cattgtcttc cgcagaggat acgtcctctt       360
     attgtcatga atgtcatgta ccgtaacatg atgaaacagg tcggcgacct ccatgaaaag       420
     gcgatcagtg attttattct tcttgatctg atcaagaact atattccaaa aacaatctgg       480
     gatatcgcca aaacctttgc acacgaacag aagatatcca ttccggaaga agaattggac       540
     ctcaccatcg tatttgccga catcaagggc ttcacggcta tgacccagca tatggaaccg       600
     aggcaggtcg tctctatcct gaatacggtc tttgaagtcg cagcaaaaca tatctatcaa       660
     aaccatggtg atatcgacaa atatattgga gatgcttttt tcgccgtttt tacaaaggct       720
     aaagaggccg tcacagccat gacggcaatg caggatgagc tggaacagat taacctgcaa       780
     cgaaaaaacc aggaacattc ccctgtagaa ttccgtgtgg gtatccattc ggggcctatc       840
     atccgcggaa atgtaggtgg ccatgatcgt tacgacaata ccttgatcgg cgatacggtc       900
     aataccgcaa gccgtctcga acatatagca cctgccggcg gtatcgttat cagtgaggag       960
     accagaacac gcatcggtat caccttacct gagtcctgta aaagtgaaac cgaactgcgc      1020
     ggcagagatt cgaagatcac cgtctacaat gcattttcgt ttctcagatc gaagctcctg      1080
     gcgcctcagg ataagtccta a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page