(data stored in ACNUC7421 zone)

EMBL: CP002116.PE207

CP002116.PE207       Location/Qualifiers
FT   CDS_pept        212996..213250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slt:Slit_1635 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79367"
FT                   /db_xref="GOA:E1RA76"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA76"
FT                   /protein_id="ADK79367.1"
FT                   /translation="MKRFILSLLIGALAGLVAGYFVFGKSGVTGSYVPVDQLFGGAKNA
FT                   LVSLSRAVTGLDHIRNEILLSGLFGASMGVHIGSIGRRR"
     atgaaacgtt ttattctgtc gctgctgatt ggtgcactgg ctggccttgt cgcaggttat        60
     tttgtttttg gaaaaagcgg ggtgaccgga agttatgtgc cggtggatca actcttcggg       120
     ggggccaaga atgctcttgt ctctttaagt cgggcggtaa ccgggcttga ccacattcga       180
     aatgaaatct tgctttccgg attgttcggg gcaagtatgg gtgtacatat cggttccatc       240
     ggaaggagac ggtag                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page