(data stored in ACNUC7421 zone)

EMBL: CP002116.PE208

CP002116.PE208       Location/Qualifiers
FT   CDS_pept        213253..215031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0211"
FT                   /product="peptidase M24"
FT                   /note="COGs: COG0006 Xaa-Pro aminopeptidase; InterPro
FT                   IPR000587:IPR000994; KEGG: bth:BT_2743 putative
FT                   aminopeptidase; PFAM: peptidase M24; creatinase; SPTR:
FT                   Putative uncharacterized protein; PFAM: Metallopeptidase
FT                   family M24; Creatinase/Prolidase N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79368"
FT                   /db_xref="GOA:E1RA77"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA77"
FT                   /protein_id="ADK79368.1"
FT                   /translation="MNNPVLPRLSALRREMEERALQAVVFFGTDPHQSEYAAPRWKDRL
FT                   WMSGFSGSAGTVVVTETEAALWTDSRYWLQATDQLDGSGIVLMADGDPSVPSLPDWLIS
FT                   KLSPGARVGVDYQTLSVASERRLSHILGTKGIALVSFESLLNDLWTDRPARPCEPLYAI
FT                   DLHYVGKSRDQKITLLRDAAKNVGADAMFLSALDEIAWLLNLRGNDIAYNPFFFSYLLI
FT                   RETDTLLFADIHAVSKELEELLAEEHITLKAYEAVGEMLREFEGTLFVDPASFSMALKG
FT                   ALSPGVRIVEEQSPVAALKARKEAVEVEGFRHALRKDGVALVRFWMRLERMLERGDGDE
FT                   ISVASLLYEERSRMPGFVGESFAPIVGFAEHGAVVHYSATKESAIPVTGRGLLLIDSGG
FT                   QYIEGTTDITRVFAVGKATEEEIFDYTTVLKAHISLATAIFPIGTVGTRLDAMARRPMW
FT                   EAGLNYGHGTGHGVGAFLGVHEGPQSISTKLLPVPIEPGMVCSNEPGVYREGKHGIRIE
FT                   NLILAVEKFNTPFGRFLGFETLTPFPFECKLIDVSLLTEGERQWVDRYHAWVFELLSSE
FT                   LNPQERSFLAAKTGVV"
     atgaataatc ctgttctccc gcggctttcc gctctgcgaa gggagatgga ggagagggca        60
     ttgcaggctg ttgtcttttt cggtaccgac cctcaccaaa gtgaatacgc cgcgccccgt       120
     tggaaagatc ggctctggat gagcggtttt agcggttccg ccgggacggt cgttgttacc       180
     gaaacagagg ctgcgctctg gaccgacagt cgctactggc ttcaggccac ggaccaactt       240
     gacggcagcg gtattgtttt gatggccgat ggtgaccctt ccgtcccttc tctccccgac       300
     tggctgattt caaaacttag tccaggagct cgggtcggtg tggattatca aaccctttcc       360
     gttgcctctg agcgccggct ttcccatatc ctgggcacca agggaatagc cctcgtttca       420
     ttcgaatctc tccttaacga cctttggacc gatcgcccag cccgaccctg tgagcccttg       480
     tatgccatcg acctccacta tgtgggtaaa tcgagggatc agaagattac actcttgcgt       540
     gatgccgcaa agaatgtcgg tgcggatgcc atgtttcttt ctgctctcga tgagattgcc       600
     tggcttctca accttcgggg aaatgatatc gcatacaatc cgtttttctt ttcctatttg       660
     ctgattcggg aaacggatac cctccttttt gcagatattc atgctgtttc gaaagaactg       720
     gaagagctgc ttgcagagga gcacattacc ttgaaggcgt atgaggcagt cggtgagatg       780
     cttcgggagt tcgagggcac gcttttcgtc gaccctgcct ctttttcgat ggccttgaag       840
     ggtgcgcttt cgcctggggt tagaattgta gaggaacaga gtcccgttgc cgctttgaag       900
     gccagaaagg aagcggtaga ggtggaaggc tttcgccatg cccttcgtaa ggacggggtt       960
     gctttggttc gcttctggat gcgacttgaa cggatgctcg aacgagggga cggagacgaa      1020
     atttccgtgg cttcgctttt gtatgaggag cgaagtcgaa tgccgggatt tgtgggagaa      1080
     agctttgccc cgattgtggg ctttgccgag catggtgcgg ttgttcatta tagcgcgacc      1140
     aaagagagtg caattcccgt cacgggaagg gggctgttgc tcatcgattc cgggggccag      1200
     tatattgaag gcaccaccga tatcaccagg gtctttgccg tcggaaaggc gacagaggaa      1260
     gagatatttg attatacaac ggtcttaaaa gcccacatct cccttgcaac cgcgatcttt      1320
     ccgataggta ccgtcggcac aaggctcgat gccatggctc ggcgaccgat gtgggaagcc      1380
     ggtttgaact atgggcatgg aacaggccac ggggttggtg cattccttgg ggtgcatgaa      1440
     ggccctcaat cgatttcaac caagttgctg cctgtcccta tagagccggg catggtctgt      1500
     tccaacgagc cgggagtata ccgggaagga aagcacggga ttcggatcga aaatctaatt      1560
     ctggctgtgg aaaagtttaa cacaccgttc gggcgctttt tgggctttga aaccctgact      1620
     ccctttccct ttgagtgtaa gcttatcgat gtttctcttc ttaccgaagg ggaacggcaa      1680
     tgggtcgatc gctatcacgc ttgggttttc gagcttctat cttcggagct caatccgcag      1740
     gagcgatcgt ttcttgccgc taagacggga gttgtctga                             1779
//

If you have problems or comments...

PBIL Back to PBIL home page