(data stored in ACNUC7421 zone)

EMBL: CP002116.PE209

CP002116.PE209       Location/Qualifiers
FT   CDS_pept        215034..215990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0212"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="COGs: COG0053 Co/Zn/Cd cation transporter; InterPro
FT                   IPR002524; KEGG: kol:Kole_0844 cation diffusion facilitator
FT                   family transporter; PFAM: cation efflux protein; SPTR:
FT                   Cation diffusion facilitator family transporter; TIGRFAM:
FT                   cation diffusion facilitator family transporter; PFAM:
FT                   Cation efflux family; TIGRFAM: cation diffusion facilitator
FT                   family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79369"
FT                   /db_xref="GOA:E1RA78"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA78"
FT                   /protein_id="ADK79369.1"
FT                   /translation="MKEKGRKPSDFRIRMIRRASWVGILGNGLLSALKVTVGFFSGSLA
FT                   LVGDGIDSATDVVTSFVSLLTAGIVERPPDNEHPYGHARAETVATKILGFLIFFAGAQL
FT                   ALSTLRSLFSGVSRPLPEFPAAMVALVSVVGKSLLAFYKLRVGRTIDSPMLIADARNMT
FT                   GDVVISLGVFAGIGATLLSGIAFLDSIIALLVSLWIMKVAFSIFMEAGDELMDGLDNPD
FT                   LYRRLFDAVGTVKGAGNPHKARIRKLGNACIVDLDIEVDGAISVAEGHEIAREVERAIH
FT                   LQLKNVYDVQVHVEPLGNLEKKERFGLSRQSLETSGK"
     atgaaagaga aggggcgaaa acccagcgat tttcgtatcc gcatgatcag gcgggcgagc        60
     tgggtcggca ttttgggtaa cggtttgctt tccgccttga aagtaaccgt tggttttttt       120
     tccggaagcc ttgcccttgt cggggatggt atcgattcgg cgacggatgt tgttacctct       180
     tttgtatcgc tcctcaccgc tgggattgtt gagcgtcctc ccgacaatga gcatccctac       240
     ggccatgcca gggccgagac cgtggctaca aagattctcg gctttctcat tttctttgcc       300
     ggagcccagc ttgctctttc gacgcttcgt tctcttttct ccggcgtttc acgtccctta       360
     cctgaattcc ccgcagccat ggttgctttg gtctcggttg tgggaaaatc cctccttgcc       420
     ttttacaagc tgcgggtcgg caggaccatc gacagcccta tgcttattgc cgatgcccgt       480
     aatatgaccg gagatgtggt gatcagcctc ggtgtgtttg ccggtatcgg agcgaccttg       540
     ctctccggta ttgcttttct tgattcgatt atcgcccttc ttgtgagcct ttggatcatg       600
     aaggttgcct tttcgatctt catggaagcg ggggatgaat tgatggatgg tctcgataat       660
     cccgatctgt atcgacgtct ctttgatgcg gttggaaccg tgaaaggagc cggcaaccct       720
     cataaggcac gtatcagaaa gcttgggaat gcctgcattg ttgatctcga tattgaggtc       780
     gacggagcga tttccgttgc cgaggggcac gaaattgcca gagaggttga gagggcaata       840
     catctgcagc tgaagaatgt ctacgatgtg caggttcatg tcgaaccctt ggggaatctg       900
     gaaaagaaag aacgattcgg tctgtcccgc caaagccttg aaacctctgg aaaatag          957
//

If you have problems or comments...

PBIL Back to PBIL home page