(data stored in ACNUC7421 zone)

EMBL: CP002116.PE21

CP002116.PE21        Location/Qualifiers
FT   CDS_pept        17596..18168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_2057 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF1393)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79181"
FT                   /db_xref="GOA:E1R6P9"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6P9"
FT                   /protein_id="ADK79181.1"
FT                   /translation="MKIRAGQLLLERPGLIFILFLGMGINLVGYYIVYWLELPLFLDSM
FT                   GTFLAAAVLGPWLGAACGFFSNLLIGLIDNPVMIPFALVNIVIGIIVGLFSLHFRFRSL
FT                   FVVIIGALVSALVSSLLGTVITVFVFGGVSGGVIDAFVAGMATSGREIFSSTFLVRLPV
FT                   NIGDKLFSAFLIWIFLLLFPERWKGYA"
     atgaaaattc gtgccggtca attattactt gaacgtccag gtttgatctt catcctcttc        60
     cttgggatgg ggatcaacct tgtcggctac tacattgtgt attggctgga gctgccgctg       120
     tttctcgaca gtatggggac atttttggct gctgctgttt taggtccgtg gttgggtgcc       180
     gcctgcggtt tcttttcaaa tctcttaatt ggacttatcg acaatcccgt tatgatcccc       240
     tttgccctgg tcaatatcgt tattggaatt attgtcggcc ttttttcctt gcattttcgt       300
     tttcgttccc ttttcgtggt tattattggg gcgctggttt ctgcccttgt tagttcatta       360
     ttgggtaccg taataaccgt atttgttttc ggcggagtta gcggaggggt tatcgacgct       420
     tttgttgcag gtatggcgac ttccggtaga gaaatttttt catccacgtt ccttgtcagg       480
     cttccggtca acattggcga taaattgttc agcgcctttc tcatctggat tttcctgcta       540
     ttgttcccgg aacggtggaa aggctatgct taa                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page