(data stored in ACNUC7421 zone)

EMBL: CP002116.PE210

CP002116.PE210       Location/Qualifiers
FT   CDS_pept        216028..217680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0213"
FT                   /product="phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent"
FT                   /note="COGs: COG0696 Phosphoglyceromutase; InterPro
FT                   IPR005995:IPR011258:IPR006124; KEGG: mca:MCA0753
FT                   phosphoglyceromutase; PFAM: BPG-independent PGAM domain
FT                   protein; metalloenzyme domain protein; PRIAM:
FT                   Phosphoglycerate mutase; SPTR: Phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; TIGRFAM:
FT                   phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; PFAM: Metalloenzyme
FT                   superfamily; BPG-independent PGAM N-terminus (iPGM_N);
FT                   TIGRFAM: 2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79370"
FT                   /db_xref="GOA:E1RA79"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA79"
FT                   /protein_id="ADK79370.1"
FT                   /translation="MVEALKANPAFSGRKGPVVLVIMDGVGFGKYTEGDAVAAAHTEVL
FT                   DELMASYPMTKLKAHGIAVGLPSDDDMGNSEVGHNAIGAGRVFAQGAKRVNGAIESGEM
FT                   FTGETWKKLTENVKKSGGSLHFLGLLSDGNVHSHINHLKAMVARAKEDGVKRVRVHALL
FT                   DGRDVGETSALDYFDPFADYLASLSDGGFDAKIASGGGRMKITMDRYNADWEMVHRGWQ
FT                   IHVLGEGRQFANAHEAIETLRKETGAIDQDLPPFVIAEGGKAVGTVEDGDSFILFNFRG
FT                   DRALEITKAFEAGDDFSEFDRVRVPNVEYAGMMEYDGDLHVPKQYLVSPPSIDKTMAEY
FT                   LAASGVKMFSISETQKFGHVTYFFNGNRSGKFSEELEEYVEIPSDRVPFEERPWMKAAE
FT                   ITDRVIEEIEKGSYRFIKLNYPNGDMVGHTGIYEAVLCSMEALDLSLGRLKKAVEKAGG
FT                   VMVISADHGNSDDMFEHDKKSGAVKTKANGKPQAKTSHSLNPVPCIVYDPGYKGEYAKE
FT                   LRSGLGISSLAATCIELLGFQAPEDYDTSVFTW"
     atggtagaag ctttgaaagc taatccggcc ttttcgggga gaaagggtcc ggttgttttg        60
     gtaattatgg acggagtcgg ttttgggaag tatacggaag gagatgccgt tgcagcggcc       120
     cataccgagg ttttggacga attgatggcg tcctacccta tgacgaagtt aaaggcccac       180
     ggaatcgccg taggccttcc cagtgatgat gatatgggaa atagtgaggt cggtcacaat       240
     gccatcggcg cgggccgtgt ctttgctcaa ggtgcaaaac gtgtaaacgg ggccattgaa       300
     tcgggagaga tgtttaccgg tgagacgtgg aagaagttga cggagaatgt caaaaagagc       360
     ggaggaagtc ttcatttcct tggattgttg tccgacggta atgtacacag ccacatcaat       420
     catctgaaag caatggttgc ccgggcaaaa gaggacggcg taaaacgagt tagggtccac       480
     gcgttacttg acggaaggga tgtaggagaa accagcgcgc tggactattt tgatcccttt       540
     gccgattatc ttgcttccct ttccgacggt ggctttgacg caaagatcgc ctcgggcggc       600
     ggaaggatga agatcaccat ggatcgctac aacgccgact gggagatggt ccaccgcggc       660
     tggcagatcc atgttctggg agaagggcga cagtttgcca atgcccatga agccatcgag       720
     acccttcgca aggaaaccgg tgctatcgat caggaccttc ctccctttgt gatcgcagaa       780
     gggggaaagg ctgttggaac cgttgaagac ggcgacagct ttatcctttt caatttcaga       840
     ggagatcgtg cgcttgagat caccaaggcc tttgaagccg gcgacgactt ttccgaattc       900
     gaccgtgtca gggttccgaa tgtcgaatat gccgggatga tggagtatga tggtgatctt       960
     catgttccga aacagtatct tgtctcccct ccctctatcg ataaaaccat ggccgagtat      1020
     ctcgcagctt cgggagtgaa gatgttctcc ataagcgaga cccagaagtt cggtcacgtc      1080
     acctatttct ttaacggaaa cagaagcggt aaattcagcg aagagttgga agagtatgtg      1140
     gaaattccct ctgatcgggt tcccttcgaa gaacgcccct ggatgaaggc tgccgaaatc      1200
     accgaccggg tcattgaaga gattgagaag ggtagctatc gctttatcaa attgaactat      1260
     ccgaatggtg atatggtcgg ccataccggc atctatgaag cggtcctctg ttccatggaa      1320
     gccttggatc tctcccttgg gcgtttgaaa aaggcggttg aaaaggccgg tggggtgatg      1380
     gtcatctcgg ctgatcacgg caacagcgac gatatgttcg aacacgacaa aaaaagcggt      1440
     gccgttaaaa cgaaagcgaa tggaaaaccc caggcaaaga caagccacag tctcaatccc      1500
     gttccctgta tagtctacga tcccggttat aagggagagt atgcaaagga actgcgttcc      1560
     ggtctgggga tttcaagcct tgcagcgacc tgcatcgaac tccttggctt tcaggcccct      1620
     gaagattacg atacgagtgt ttttacctgg tga                                   1653
//

If you have problems or comments...

PBIL Back to PBIL home page