(data stored in ACNUC7421 zone)

EMBL: CP002116.PE211

CP002116.PE211       Location/Qualifiers
FT   CDS_pept        complement(217731..218495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0214"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="COGs: COG1349 Transcriptional regulators of sugar
FT                   metabolism; InterPro IPR001034:IPR014036:IPR018356; KEGG:
FT                   cbt:CLH_0701 deoxyribose operon repressor; PFAM: regulatory
FT                   protein DeoR; SMART: regulatory protein DeoR; SPTR:
FT                   Transcriptional regulator, DeoR family; PFAM: Bacterial
FT                   regulatory proteins, deoR family; DeoR-like
FT                   helix-turn-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79371"
FT                   /db_xref="GOA:E1RA80"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA80"
FT                   /protein_id="ADK79371.1"
FT                   /translation="MNSSLRRGHLIDYLKNSRSATIQELAEHFEVSHMTIRRDLEKLIE
FT                   NQPIKIIHGGVIYQESGQGDHYSIIKARTHMLEAKKKIAKKAASLVEADDIIIIDAGST
FT                   GELIAEFLPKDRPITIICYALNIATVVSKRENCTLILTGGCYHGSSMVFESEEGLSLIK
FT                   RNRAKKAFVTASGISAKLGITCSNFFESTTKRIALKSSLTTILVADSSKFGEIQNGYFS
FT                   DLSDFDIIITDEGLPPEFRKEIARLEKTLYIE"
     atgaacagca gcctacggcg cggacatctc atcgactatc tgaaaaacag ccgttcggcg        60
     acgattcaag agcttgccga gcactttgag gtttcccata tgaccattag aagggatctc       120
     gagaaactta tcgagaatca gccaattaaa atcatccatg gaggagtcat ctatcaggag       180
     tctgggcagg gagatcacta ctcaattatc aaagccagga cgcacatgct tgaagcgaaa       240
     aaaaagatcg caaaaaaggc agcatccctc gtcgaagccg acgacatcat tattatagac       300
     gcaggttcga ccggtgagct cattgccgaa tttctgccta aagacaggcc tattacgata       360
     atctgctatg cgcttaatat tgcaacagtg gttagcaagc gtgaaaactg tactctaatc       420
     cttaccggcg gctgttatca cggaagttct atggtctttg aaagcgaaga ggggcttagt       480
     ctgattaaac gtaaccgggc aaaaaaagcg ttcgttaccg ccagtgggat cagtgcaaag       540
     ctggggatta cctgttctaa ttttttcgaa agcacaacga aacggatcgc actaaaatca       600
     tccctcacga cgatcttagt cgccgactca tcaaaatttg gtgaaataca gaatggttat       660
     ttttccgacc tttccgattt tgatatcatt attaccgatg aaggccttcc tccggaattc       720
     agaaaggaaa ttgcacgatt ggaaaaaacg ctctatatcg aataa                       765
//

If you have problems or comments...

PBIL Back to PBIL home page