(data stored in ACNUC7421 zone)

EMBL: CP002116.PE212

CP002116.PE212       Location/Qualifiers
FT   CDS_pept        218708..219700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0215"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /note="COGs: COG1879 ABC-type sugar transport system
FT                   periplasmic component; KEGG: cro:ROD_24811 ABC transporter,
FT                   substrate-binding protein; SPTR: ABC transporter,
FT                   substrate-binding protein; PFAM: family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79372"
FT                   /db_xref="GOA:E1RA81"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA81"
FT                   /protein_id="ADK79372.1"
FT                   /translation="MKKIVLIIVIVLVLLPLHLFAGGQKDAADANKYEIVTVVKITGIP
FT                   WFNRLEEGVDAAAKDLDVNAYQIGPSDADPAQQVKMVEDLISKGVDAICITPNDATALE
FT                   PVFQKAKEKGILILTHESPDQAGKDVDIELIDNVEFGRHTWDMLVKYMGDKGQYAIFVG
FT                   GLTVPLHNLWADEGLKYAKEHYPGLELVTSRIPCGEDQELAKQKTLELLKTYPDLKGII
FT                   GFGSLGPPGAAQALKEKGLAGKVAVVGNVIPGHAAPYLKDGSMSHGVLWDPKDAGYSLT
FT                   YVAKYLLDGGSLADLKEIPGIGAVVVDGDVIKVDAMADITKENVDSFGF"
     atgaagaaga tcgttcttat tatcgtgatc gttcttgtac tgttgccgtt gcatctcttc        60
     gccggtgggc aaaaagatgc cgcagacgcg aataagtacg agattgtgac agtcgtaaag       120
     atcacgggaa ttccttggtt caatcgtctt gaagaaggag ttgatgcggc tgccaaagat       180
     cttgacgtga atgcttacca aattggacca tccgatgcag accctgctca gcaggtcaag       240
     atggtggaag acttgataag taaaggcgtt gatgccatct gcattacacc aaatgatgct       300
     accgctctcg aacctgtgtt ccagaaggct aaagagaagg gcatattaat cctgacccat       360
     gaatcaccgg atcaggcggg taaggatgtc gatatcgagc ttatcgataa tgtggaattt       420
     ggtcgccata cctgggatat gcttgttaaa tacatgggtg ataaagggca atacgccatt       480
     tttgtaggcg gccttaccgt cccccttcac aacctttggg cagatgaagg ccttaaatat       540
     gcaaaggagc actaccctgg gctcgagctg gtaaccagcc ggattccctg cggtgaggac       600
     caggaacttg ccaagcaaaa gacgcttgag ctgctgaaaa cttatccgga tttgaagggt       660
     atcatcggtt tcggaagtct gggacctccg ggagctgctc aggccttgaa ggaaaaaggc       720
     ctggctggaa aggttgccgt tgtcggaaac gtcattcccg gacatgctgc gccctatttg       780
     aaggacggat ccatgagcca tggtgttctc tgggatccga aggatgccgg ctactctctg       840
     acttacgtgg caaagtatct tcttgacggc ggtagccttg ccgacttgaa agagattccc       900
     ggaatcggtg ccgttgtagt ggatggggat gttatcaagg ttgatgccat ggctgatatc       960
     acaaaggaaa atgttgacag tttcggtttc tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page