(data stored in ACNUC7421 zone)

EMBL: CP002116.PE213

CP002116.PE213       Location/Qualifiers
FT   CDS_pept        219776..221278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0216"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1129 ABC-type sugar transport system ATPase
FT                   component; InterPro IPR003593:IPR003439:IPR017871; KEGG:
FT                   rle:pRL80086 putative ATP-binding component of ABC
FT                   transporter; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; SPTR: ABC transporter ATP binding protein; PFAM:
FT                   ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79373"
FT                   /db_xref="GOA:E1RA82"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA82"
FT                   /protein_id="ADK79373.1"
FT                   /translation="METLFLSMKQITKVYAGVRALDGVDFSIARGEIHCLAGTNGSGKS
FT                   TLVKIISGVVAPEAGAEIIMDGELLDQHTSRTAISHGVEVIYQDLSLFPNLTVAENIAV
FT                   SSNIAQRRYLMDWKRAETTATKAMNRIGISIPLDARVGELSMADQQLVAICRALTGDVR
FT                   LLIMDEPTTALTKKEIDALLRVVIELKNKGIASLFISHKLNEVMQIAERVTVLRDGTLI
FT                   GTYDGKTIDDKKLEFLMTGETSVYEPYHVSPDRNGKPILRLENFSRNHSFCNVSLEVYS
FT                   GEIVGITGLLGSGRSELALSIFGFHPADSGRMEMNGEEVSIDSVETAKHHGIAYVPEDR
FT                   IHQGLVMDQSVSRNLVATVIDRLQGKTSLIDTKKLHETVAYWVETLKIKVPSLDAPVKT
FT                   LSGGNQQRIVLGKWIATEPRLFILDNPTVGIDVSAKSSIHKTIKKLAREGMGVIIISDE
FT                   ISEVLNNCSRILVMHKGRIIGSFDTTEASEEEIQAFIESQSI"
     atggaaacac tttttctttc aatgaagcag attacaaaag tgtatgctgg ggttcgtgct        60
     ctggacgggg tagatttttc catcgctcgc ggggaaatac attgtctggc tggtacgaat       120
     ggttcgggaa agtcgacatt agttaagatt atttccggag ttgtagctcc cgaagcggga       180
     gcggaaatca tcatggatgg agaactgctg gatcagcata cctctcggac ggccattagt       240
     catggtgtag aggtaatcta tcaggacctt tcgctttttc cgaatttaac agtggcggaa       300
     aatattgctg tgagtagcaa tattgcccaa cggcgatatc tcatggattg gaagcgtgcc       360
     gaaacgacgg ccacaaaggc catgaacagg attgggattt ctattccttt ggatgccaga       420
     gtaggtgaac tctccatggc ggaccagcag ttggtggcta tttgcagggc tcttactggt       480
     gatgttcggt tgttgattat ggatgaacct actacagccc tgacgaagaa ggagattgat       540
     gcccttttgc gtgttgttat tgagctaaaa aataagggga ttgccagcct gtttattagt       600
     cataaactta acgaagtaat gcagattgcc gaacgcgtca cagttctcag agacggaaca       660
     ttaatcggta catacgacgg caaaacaatt gatgataaaa aattagaatt tcttatgaca       720
     ggagagacct ctgtgtatga gccctatcat gtatctcctg accgtaatgg gaaacccatt       780
     cttcgactgg aaaatttttc caggaaccat agtttttgta atgtaagtct ggaagtctat       840
     tcaggagaaa tagtcggcat aacagggctt ttaggttctg gaaggagtga acttgctctt       900
     tctattttcg gctttcatcc tgcagactcg ggacggatgg agatgaacgg tgaggaggtt       960
     tcgattgatt cggttgaaac tgccaaacac cacggaattg cttatgtgcc ggaagatcgg      1020
     atccatcagg gactggtaat ggatcagtcg gtttccagaa acctggtggc gaccgttatc      1080
     gatcgtcttc aggggaaaac ttcacttatc gatacaaaaa aactgcatga gaccgttgcc      1140
     tattgggttg agacgctaaa aatcaaagtg ccttccctgg atgcaccggt aaagacccta      1200
     tccggcggga atcagcagcg gattgttctc ggaaaatgga tagctaccga accccgactc      1260
     tttattcttg ataacccgac cgtcggtata gatgtttccg caaaaagcag tatccataag      1320
     acgataaaaa aactggcacg ggagggaatg ggtgtcatca tcatttcaga tgagatttcc      1380
     gaggtgctga acaattgttc gagaatttta gtgatgcata aagggcgtat tatcgggtcc      1440
     tttgatacaa ccgaggccag tgaagaagag attcaggcct tcatcgaatc gcaaagtata      1500
     tag                                                                    1503
//

If you have problems or comments...

PBIL Back to PBIL home page