(data stored in ACNUC7421 zone)

EMBL: CP002116.PE214

CP002116.PE214       Location/Qualifiers
FT   CDS_pept        221290..222297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0217"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG1172 Ribose/xylose/arabinose/galactoside
FT                   ABC-type transport systems permease components; InterPro
FT                   IPR001851; KEGG: cro:ROD_24831 putative ABC transporter
FT                   membrane protein; PFAM: inner-membrane translocator; SPTR:
FT                   Ribose/xylose/arabinose/galactoside ABC-type transport
FT                   systems permease component 2; PFAM: Branched-chain amino
FT                   acid transport system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79374"
FT                   /db_xref="GOA:E1RA83"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA83"
FT                   /protein_id="ADK79374.1"
FT                   /translation="MKRFMKTHEFHVLVVVLILSAAITAVNPNFLTLENGFDLLKSYSF
FT                   MGVLAIGILFVLISGGIDISFAATATVAEYVMAVVSIKLGGNMITSLLLATLVGLLLGA
FT                   FNGFLISKFKIAPIITTIATMNFYYGILTVITGGKWIYALPEWFRAFADIRVFTLVSRA
FT                   GTPYGLSVITLFWAVITVLAFFLLRYTMLGRGIYAIGGDIGSAERVGFPVRRLQIFVYS
FT                   FMGMMAGIAGVIQALLVQTVAPNSIVGKELDVIAAVVLGGASLSGGFGSVGGTLLGVFL
FT                   IAVVKNGMTLVKIPAVWYDVFIGAVILISVGFTSWQGKKGYHQAVIDIEKEEAA"
     atgaaacgtt tcatgaaaac ccatgaattc catgtattgg tggttgttct tattctctct        60
     gctgccatca ccgcggtaaa tccgaatttt cttaccttgg agaatggatt tgatcttttg       120
     aaaagctatt cttttatggg tgttctggcc atcgggattc tttttgttct gatctccgga       180
     gggatcgata tttcatttgc tgccacggca accgttgctg agtatgtgat ggcggtagtg       240
     agtatcaagt tgggcggaaa tatgattaca tcattgctcc ttgccactct ggtaggtctc       300
     ctgctgggag cctttaacgg ctttctcatc tcaaagttca agattgcccc tatcataacg       360
     accattgcca ccatgaattt ttactatgga atccttacgg tgataaccgg cgggaagtgg       420
     atctatgccc ttcccgaatg gtttcgcgcc ttcgccgata ttagggtttt tacccttgtt       480
     tccagggctg gaacgcccta tgggctttcc gtcattaccc ttttctgggc agtgattacc       540
     gttttggctt tttttctcct ccgttataca atgcttggtc ggggtatcta cgccattggc       600
     ggggatatag gctcggccga acgggtcggt ttccctgtga gacggcttca gatttttgtt       660
     tattccttta tgggcatgat ggccgggatt gccggtgtaa ttcaggcgtt gcttgtacaa       720
     accgttgcac cgaactccat agtcggaaag gagttggatg ttattgccgc ggttgtgctt       780
     ggcggagcaa gcctttccgg tggtttcggg agtgtcggtg gaaccctgtt gggagttttt       840
     cttattgccg tcgtcaaaaa cggaatgacc ctcgtcaaga tcccggccgt ttggtacgac       900
     gtctttatcg gtgcggttat tctcattagt gttggattta cctcttggca agggaaaaaa       960
     ggatatcacc aggccgttat cgatatcgaa aaagaggagg ccgcataa                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page