(data stored in ACNUC7421 zone)

EMBL: CP002116.PE215

CP002116.PE215       Location/Qualifiers
FT   CDS_pept        222297..223274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0218"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG1172 Ribose/xylose/arabinose/galactoside
FT                   ABC-type transport systems permease components; InterPro
FT                   IPR001851; KEGG: spe:Spro_4696 monosaccharide-transporting
FT                   ATPase; PFAM: inner-membrane translocator; SPTR: Putative
FT                   uncharacterized protein; PFAM: Branched-chain amino acid
FT                   transport system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79375"
FT                   /db_xref="GOA:E1RA84"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA84"
FT                   /protein_id="ADK79375.1"
FT                   /translation="MKRKELRVLTIIMVLSFVFMTVLNPRDFLRAGNFQGMAFQLPELG
FT                   VLSLAMMIVMLTGGINLSIIATADLAGIVAAMILTIPKFGGVQAPGWLVMLALVGAIAA
FT                   ALLVGLLNGVLIAYIGVAPILTTLGTMTLINGITIVLTKGYVISGFPPAVRFIGNGMLL
FT                   GIPFPLLLFGLLAVVMAIFLNRTPTGFNIYMYGSNDVATHFYGGNNAGIILRTYLVSGL
FT                   LSGFAALIMISRFNSAKAGYGASYLLVTILAAVLGGVSSEGGFGRVSGLILSLVTLQII
FT                   SSGLNLLRVSSFMTIAIWGFVMILVMVVNYYSDKRRERLLRTQG"
     atgaaacgga aagaattgcg ggttttgacc attatcatgg ttctctcttt tgtgtttatg        60
     acggtgctca atcctcgaga ttttctgcga gccggaaact tccagggtat ggcttttcag       120
     cttcctgagt tgggggttct gtcgcttgcc atgatgatcg ttatgcttac gggtggtata       180
     aatctttcca ttatcgctac tgccgatctc gccggtattg ttgctgcgat gattcttacg       240
     attccgaagt ttggcggagt tcaagctccc ggatggctgg ttatgcttgc tcttgtaggg       300
     gcaattgcag ccgcattact cgttgggttg ttaaacggag tattaattgc ttatatcggt       360
     gttgctccca ttcttaccac tttgggtaca atgaccctta taaacggtat aactatcgtt       420
     ttaacaaagg ggtatgtcat ctccggtttt ccgccagcgg ttcgctttat cggaaacggg       480
     atgcttttgg gaatcccgtt tccacttctt ctttttgggc tgctcgcagt cgttatggcc       540
     attttcttga atcgtacacc aaccggattt aatatttaca tgtacggttc gaatgatgtt       600
     gctactcact tttatggtgg gaacaatgcc ggtatcatct tgcggacgta tcttgtttcc       660
     gggctgcttt ccgggtttgc ggctcttatc atgataagcc gttttaattc tgccaaggca       720
     ggttacggtg cttcttattt gcttgtaacc attcttgccg ctgtccttgg cggggttagt       780
     agcgagggag gttttggacg ggtttccggg cttatcctct cgcttgttac attacagatt       840
     atatccagcg gcctcaatct actaagggta agctcgttta tgaccattgc aatctggggt       900
     ttcgtaatga ttttggtaat ggtcgtaaat tactacagtg ataagcgcag ggaacgactg       960
     ctgcggactc aaggatga                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page