(data stored in ACNUC7421 zone)

EMBL: CP002116.PE216

CP002116.PE216       Location/Qualifiers
FT   CDS_pept        223288..224763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0219"
FT                   /product="Carbohydrate kinase, FGGY"
FT                   /note="COGs: COG1070 Sugar (pentulose and hexulose) kinase;
FT                   InterPro IPR018484:IPR018485; KEGG: ttr:Tter_2252
FT                   carbohydrate kinase FGGY; PFAM: Carbohydrate kinase,
FT                   FGGY-like; SPTR: Putative uncharacterized protein; PFAM:
FT                   FGGY family of carbohydrate kinases, N-terminal domain;
FT                   FGGY family of carbohydrate kinases, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79376"
FT                   /db_xref="GOA:E1RA85"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA85"
FT                   /protein_id="ADK79376.1"
FT                   /translation="MSGKEIHCVGFDCGNSSIRTVLGHFDGTNIEVELIQQVPNGTVRV
FT                   EGYDYWDILHIFSQMQQGLKQAVAAAGGTVASAGISTWGIDFGLFGPSGQLLGNPLCYR
FT                   NELGGLGLGTLGEESRKKMFEQSGIQNHPMNSVYQFVGIRDHLPEYYRLAEKMMLTPDL
FT                   LNFLFTGSFNTETSIASTTQLMNMRSGRFDDSLFDIAGIKKGIMPPVVDHGTVRGMLRQ
FT                   DIADYLDIAPLPFVAVPSHDTAAAVVTVPSLEGPFAFISSGTWSLIGTELSAPLINDEV
FT                   YNCELANEGGACGTITLLKNSAGMHILQNVKNELEMRENRRFAWDEVVDLSLKAAAFLG
FT                   DEKIPLFDPNHPSLYNPDSMIQALQLLTGEKKLDNILAGIYASLACNYGAAICDIEKIT
FT                   GTEYPVIHIIGGGCRNDHLNQMTADISGKPVVAGPVEATSLGTIAVQLMHHVPGLGLTD
FT                   IRKIVSDSVQPLRFEPKVGRDRLYQRYEELLKP"
     atgagcggaa aagagataca ttgtgtcgga tttgattgcg gaaactcatc aatcagaacg        60
     gtactgggac acttcgacgg cacgaatatt gaagtagaac ttattcagca ggttcccaac       120
     ggaacggttc gagtcgaggg gtacgattac tgggatatcc tgcatatttt ttctcaaatg       180
     cagcaaggcc tgaaacaggc ggttgccgct gccggcggta cggtggcttc tgcaggcatt       240
     tcaacctggg gaatagattt cgggcttttc ggcccttccg gccagcttct tggtaatccc       300
     ctctgctatc gcaacgaact gggagggctt gggctcggaa ccctcggcga agagagcaga       360
     aaaaagatgt tcgaacagag cggaattcaa aatcatccca tgaattccgt ttatcagttt       420
     gtggggattc gggaccatct tcccgaatat taccgccttg cagaaaaaat gatgttaacc       480
     cccgatctcc ttaactttct ttttacaggg agctttaata ccgaaacatc catcgcctcg       540
     accactcaat tgatgaatat gcgttcgggc aggtttgacg acagcctgtt cgatattgcg       600
     gggatcaaaa aggggatcat gccccctgtt gtcgaccatg gtacggtgcg cggcatgctc       660
     cgccaggaca ttgccgacta tttggatatt gctccgctac cctttgttgc tgttcccagc       720
     catgacacgg ctgctgcggt ggtaacggtg ccctctcttg aagggccctt tgcctttatc       780
     agttcgggta cctggtctct catcggtacc gagctttctg cacctttgat caacgatgag       840
     gtctacaact gcgaattggc caacgagggg ggagcctgtg gcacgattac tctcctcaaa       900
     aattccgcag gaatgcacat ccttcagaat gttaaaaacg agcttgagat gagggaaaat       960
     cgtcgtttcg cttgggatga ggttgtggat ctttctctga aggccgctgc ttttctcgga      1020
     gacgagaaga tcccgctttt cgatcccaac cacccttctc tgtataatcc cgacagcatg      1080
     attcaggccc tccagctact taccggggaa aagaaactcg ataacatttt ggctggaatt      1140
     tatgcatccc ttgcctgtaa ctacggagct gccatttgcg acattgagaa aataaccggt      1200
     accgaatacc ctgttattca tattatcggc ggcggttgca gaaacgatca tctgaaccaa      1260
     atgacggccg atatttccgg taaaccggtt gttgccggcc ctgttgaggc aacttctctc      1320
     gggaccattg ccgtacagct catgcaccac gttccgggac ttggacttac ggatatccgc      1380
     aagatcgttt ccgattcggt gcaacctctg cgtttcgagc cgaaggtagg tagggataga      1440
     ctctaccagc ggtacgaaga gcttttgaag ccctga                                1476
//

If you have problems or comments...

PBIL Back to PBIL home page