(data stored in ACNUC7421 zone)

EMBL: CP002116.PE217

CP002116.PE217       Location/Qualifiers
FT   CDS_pept        complement(224839..225072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ton:TON_0294 hypothetical protein Plut_1211;
FT                   SPTR: Putative Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79377"
FT                   /db_xref="GOA:E1RA86"
FT                   /db_xref="InterPro:IPR025517"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA86"
FT                   /protein_id="ADK79377.1"
FT                   /translation="MNKKALLIINPILFLSLLVQGISGIFMKFGLFYSLMYGIHSITGF
FT                   IFLGIVTLHIVFNWNWIKANLRKKSKRADQHA"
     atgaataaaa aagcgcttct tattatcaac ccaatccttt tcctttcttt gctcgttcag        60
     gggatctccg ggatcttcat gaaattcggg ctgttttatt cactgatgta tggaatccac       120
     tccatcaccg gattcatttt tcttggcata gttaccttgc acatcgtgtt taactggaat       180
     tggataaaag ccaatcttcg caagaaatcc aaacgagcgg accaacacgc ataa             234
//

If you have problems or comments...

PBIL Back to PBIL home page