(data stored in ACNUC7421 zone)

EMBL: CP002116.PE218

CP002116.PE218       Location/Qualifiers
FT   CDS_pept        complement(225069..225572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0221"
FT                   /product="DOMON domain protein"
FT                   /note="InterPro IPR005018:IPR013050; KEGG: ton:TON_0876
FT                   DOMON; PFAM: DOMON domain protein; SMART: DOMON domain
FT                   protein; SPTR: DOMON; PFAM: DOMON domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79378"
FT                   /db_xref="InterPro:IPR005018"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA87"
FT                   /protein_id="ADK79378.1"
FT                   /translation="MKRVLFILFLAFLILTPLAAATESTREIAGVTVTWKAEGEYVLIT
FT                   MSAKTTGWIAVGIEPENKMKGADMYIGYVDDKGAVVLEDHYGHRTFSHKSDVALGGSSD
FT                   VEIIQGTESGGETSITFRIPKNSRDVYDKLLEEGKEYTVITAWGEKDNLTARHKGRGSG
FT                   SLPL"
     atgaaaagag tattgtttat tttgttcctg gcttttctga tacttacccc cttagctgca        60
     gcaaccgaaa gcacgagaga aatcgccgga gtaaccgtga cctggaaagc ggaaggcgag       120
     tatgtcctca taaccatgtc cgcaaagacc accggctgga tagccgtcgg catagaaccg       180
     gagaataaga tgaagggcgc cgatatgtac attggctatg tggatgacaa gggtgcagtt       240
     gttttggagg atcactatgg gcacagaacc tttagccaca agagtgatgt ggcactaggt       300
     ggttcctccg atgtagagat tattcaggga accgaaagcg gaggagaaac ctctattacc       360
     ttccggattc caaaaaacag cagggatgta tacgataaac tcctcgaaga gggaaaagaa       420
     tacacggtga ttacggcatg gggagagaaa gacaatctaa ctgcacgtca caaaggcagg       480
     ggatcgggga gcttaccgct atga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page