(data stored in ACNUC7421 zone)

EMBL: CP002116.PE219

CP002116.PE219       Location/Qualifiers
FT   CDS_pept        complement(225742..228162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0222"
FT                   /product="pyruvate formate-lyase"
FT                   /EC_number="2.3.1.54"
FT                   /note="COGs: COG1882 Pyruvate-formate lyase; InterPro
FT                   IPR010098:IPR004184:IPR001150; KEGG: str:Sterm_1074
FT                   pyruvate formate-lyase; PFAM: pyruvate formate-lyase PFL;
FT                   formate C-acetyltransferase glycine radical; PRIAM: Formate
FT                   C-acetyltransferase; SPTR: Putative uncharacterized
FT                   protein; TIGRFAM: pyruvate formate-lyase; PFAM: Glycine
FT                   radical; Pyruvate formate lyase; TIGRFAM: pyruvate
FT                   formate-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79379"
FT                   /db_xref="GOA:E1RA88"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR010098"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA88"
FT                   /protein_id="ADK79379.1"
FT                   /translation="MNKRIAALRERLFEKIPEICPERAVLFTESMKQSEGQPIAKRRAQ
FT                   ALYEVLDKMTIFVRDGELIVGNQASTTRGAPAFPEYSVDWIIKEFNGDPYHFAERPCDR
FT                   FTYSERTKEQLLATIDYWKGKTLFENVWSQLPEEARVAWEINAIDDTWCAAAGLGNVLP
FT                   DHQMVLEQGLERIIERAEKRIADLDLTEPGTISQYWFLQAVVTANKAVINFAGRFADLL
FT                   LDLAEKERDQVRKKELLTMSENCRQVPAKPAQSFWQAIQAVWFIQLILQIETNGHAISL
FT                   GRFDQYLWPYFQRDIQRGVLTREKALELVESFFIKANEINKLRSWADSEYFPGYHLAEN
FT                   LAIGGQTADGRDAVNELTYTILDATADLKLTKPSVSLKWFEGTSDEFMDKALSVVEAHK
FT                   GGQPALYNDLAVMRILDNMGVKKEDQYGWAPVGCIEATVPGKWDFAAKGSWLNVGKIFE
FT                   MTLNNGKDPATGITLMKGEGDLTAFSDTHAIMEACKKQLFYYMRLQVIVEHISDEMHIL
FT                   HDQNAFRSSLVHDCIERGKSLIEGGAVYTADGGPAAGHISVGDSLAAIEYAVFEKGILS
FT                   LSQLQHALSTNFEDQTTSPSGEEIRQLMIHKAPKFGNDDDAADKWTVEINEFLGSTYQK
FT                   AFKSSRYGKGPIPATFALSQSSVTGNVAFGKSVGALPCGRKAGEPVNNGVSPANGSERN
FT                   GPTAVINSEAKLPSIWFQKGSIFNMRLTPQTLSTAEGRKRTLALVKTHFKNYQYHIQFN
FT                   VLDDATLEEAQKKPEEYRDLMVRISGYSAFFTPLNKELQNDVIARMKFNMADK"
     ttgaataagc gaatagcagc tttacgggaa aggcttttcg agaagatccc ggaaatttgt        60
     ccggaaagag ccgttctctt taccgaatcg atgaaacaat cggaaggtca acccattgca       120
     aaacgaagag cccaggccct ttatgaggtt ctggataaga tgacgatctt tgtcagagat       180
     ggcgaactga ttgtaggaaa tcaggccagc accacgagag gggctcccgc ttttcccgaa       240
     tattcggtcg actggatcat aaaggagttt aacggcgatc cctaccattt tgccgaacgc       300
     ccctgtgata ggtttaccta ttcggagagg accaaggaac aactccttgc caccattgat       360
     tactggaaag gaaaaaccct tttcgaaaac gtctggagtc agctccccga agaggcacgc       420
     gtagcctggg agatcaacgc catcgacgat acctggtgtg cggcagcggg tttggggaac       480
     gtacttcccg atcatcagat ggtcttggaa caaggattgg aacggatcat cgagcgggca       540
     gagaaaagga ttgcagacct cgatctcacc gaaccgggaa ccatttcgca gtactggttc       600
     cttcaggccg tcgtaacggc aaataaggca gtgatcaatt ttgccggtcg tttcgccgat       660
     ttgcttctcg atcttgcgga aaaagagcgc gatcaggtcc gcaagaaaga gttactcacc       720
     atgtcggaaa actgtcggca ggtaccggca aagccggcac aaagcttttg gcaagcaatc       780
     caggcggttt ggttcattca gcttatcctt cagattgaaa ccaacggcca tgcaatctcc       840
     ctgggacgct ttgatcaata tctgtggccg tattttcagc gagatatcca acgtggcgta       900
     ctgacgaggg aaaaagccct tgagttggtg gaatccttct tcatcaaggc aaacgaaatc       960
     aacaagctgc gctcgtgggc ggatagtgaa tactttcccg gctaccatct tgcggaaaat      1020
     cttgctatcg gcggtcaaac agcagacggc agggatgcag taaatgagct tacctacacc      1080
     attctcgacg caaccgccga tctgaaactt acgaagcctt cggtctcact gaaatggttc      1140
     gaagggactt ccgacgaatt catggataaa gcactcagtg tcgttgaagc ccacaaggga      1200
     ggacagcccg ccctctacaa cgatcttgcg gtcatgagaa tcctggacaa catgggtgtc      1260
     aaaaaggagg accagtacgg ctgggctccg gtagggtgta ttgaggcaac cgtaccggga      1320
     aaatgggatt ttgctgcaaa gggctcctgg ctgaacgtcg ggaaaatttt tgagatgacc      1380
     ctgaacaacg ggaaagatcc tgcaacgggc atcaccctca tgaaaggaga gggagatctt      1440
     accgcttttt ccgacaccca tgccatcatg gaggcatgta aaaagcaact tttttactac      1500
     atgcgccttc aggtcattgt cgaacatata agtgatgaaa tgcatatcct acacgaccag      1560
     aacgctttcc gctcctcact ggtacacgac tgcatcgagc gaggtaaatc gctcatagag      1620
     gggggggctg tgtataccgc cgacggcggt cctgctgccg gccacatttc ggtcggagat      1680
     tcccttgccg caattgaata tgccgtcttt gaaaaaggaa tcctctctct gtcccagttg      1740
     cagcacgcct tatcaaccaa ttttgaagat cagaccacca gcccaagtgg ggaggaaatt      1800
     cggcagttga tgatacataa ggctcccaaa ttcggtaacg atgatgatgc ggcggataaa      1860
     tggacggtgg agatcaacga gtttctggga tcgacctacc aaaaggcatt caaaagcagc      1920
     cgatacggga aggggccaat tcctgcaacc tttgcactga gccaaagctc tgtaaccggt      1980
     aacgtagcct tcgggaaatc cgtgggcgcc cttccctgcg gaagaaaagc gggagaaccg      2040
     gtcaacaatg gggtatcccc ggcaaacgga tcggaacgaa acggccctac cgcagtcatc      2100
     aactccgagg caaaacttcc gagtatctgg tttcagaagg gatcgatctt caacatgcga      2160
     cttacaccgc aaacgctctc aacggcagag ggccgaaagc gaaccctggc gctggtaaaa      2220
     acccatttca agaattacca ataccatatc caattcaacg tgctcgatga tgcaaccctg      2280
     gaagaggccc agaaaaagcc cgaagaatat cgggatctca tggtaaggat ttccggctat      2340
     agtgctttct tcactccctt gaataaagag ctccagaacg atgttattgc cagaatgaag      2400
     ttcaacatgg ccgacaaata a                                                2421
//

If you have problems or comments...

PBIL Back to PBIL home page