(data stored in ACNUC7421 zone)

EMBL: CP002116.PE22

CP002116.PE22        Location/Qualifiers
FT   CDS_pept        18168..19775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0022"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COGs: COG3920 Signal transduction histidine kinase;
FT                   InterPro IPR001638:IPR003594:IPR011495:IPR005467; KEGG:
FT                   rci:LRC120 signal transduction histidine kinase; PFAM:
FT                   histidine kinase dimerisation/phosphoacceptor; ATP-binding
FT                   region ATPase domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; extracellular solute-binding protein
FT                   family 3; SPTR: Multi-sensor signal transduction
FT                   multi-kinase; PFAM: Histidine kinase; Histidine kinase-,
FT                   DNA gyrase B-, and HSP90-like ATPase; Bacterial
FT                   extracellular solute-binding proteins, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79182"
FT                   /db_xref="GOA:E1R6Q0"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6Q0"
FT                   /protein_id="ADK79182.1"
FT                   /translation="MRNFFAVLFFSLVICVPEIFCLQNLTVVGGANGNVPYEYLDDKGR
FT                   PRGILVDVWDLWSKESGVEVSYLLVDNFKDVMDLAGNDASGPIVLAHDRIPGFSDDAGR
FT                   FEHGEVYYEVQPSIFYHKRISGIIRIEEMAGYVVGVAADSGIEAPLAEAYPSLVIRSYD
FT                   SRQALLAAVLSHQIHLFVGYPPSMIHQIGITGNARAFRSGKALSFSMPFAPVLVKGPKE
FT                   LLEDIQEGFSSMSPFARNLTIHRQTGFFRGWSIRWPLIAAVGLVLMVGLLFSLFWFWKL
FT                   QLDKRIRQATDALVEQRRQLEISRDALAHALREKEILLKEIHHRVKNNLQIISSLANLI
FT                   RNTGGTTDEGRDRFAELQSRVVSMAKVHEVIYTNEQFEQVPLRDLIKEISELLISSIGM
FT                   GLAIRLSVKCDNLAINVGDATAFSLIIHEAVANAIKHAFAPGRNNVLEILVREINNTVV
FT                   LCIKDNGAGFPAELDFDGKNHLGLFMIKQLATQLRGEFVLKNCGYEGSGAQITVEFPLP
FT                   EARFVGLPEENNRDYLRR"
     atgaggaatt tctttgccgt tttgtttttt tctctcgtta tttgtgttcc ggagattttt        60
     tgtctacaga atctgacggt agtgggggga gcaaacggca acgtccccta tgaatacctt       120
     gatgacaagg gccgccccag aggaatcctg gtggatgtat gggatctttg gtcaaaagaa       180
     agtggggttg aggtttccta tctcctggtc gataacttca aagatgtcat ggatcttgcc       240
     ggaaacgatg catccggtcc tattgtactt gcccatgatc gtatccccgg tttttccgat       300
     gatgccggtc ggtttgaaca tggtgaggta tattatgagg ttcaaccttc cattttctat       360
     cacaaaagaa tcagcggtat tatcaggatt gaggaaatgg ccggatatgt ggtgggagtc       420
     gctgctgatt ccgggataga agcgcctctt gcagaggctt atccttcttt ggtgatcaga       480
     agctatgaca gcagacaggc attgttggct gccgtcctga gccatcaaat tcatcttttt       540
     gtcggttacc ccccttctat gattcatcag attggtatca ccggaaatgc ccgtgccttt       600
     cgttcgggga aggcactttc gttttcaatg ccctttgcac ctgtactggt aaagggcccg       660
     aaagagcttc tggaagatat tcaagaaggt ttttcctcaa tgagcccctt tgcccgcaat       720
     cttacaattc accggcaaac tggtttcttc aggggatggt cgatccgctg gccgctaata       780
     gcagcggtag gcctcgttct tatggttggc ttgcttttct ctctcttttg gttctggaaa       840
     cttcaattgg acaagcgcat tcgtcaggca accgatgccc ttgtcgagca gcgtcggcag       900
     ttggagattt cccgggatgc actggcacat gcccttcgtg agaaagaaat tcttctcaaa       960
     gagattcatc atcgagttaa aaacaacctc cagattattt caagtttggc caatcttatc      1020
     cggaatacag gaggtaccac cgacgaggga agggatcgct ttgccgaact ccagagccgc      1080
     gtcgtttcaa tggcgaaagt acatgaagtg atctatacca acgagcagtt cgagcaggtt      1140
     cctctgcggg atctcattaa ggagataagt gaattgctta tttcttccat cggtatgggc      1200
     ttggctattc gtttgtcggt caagtgcgat aaccttgcca taaatgttgg tgatgcgacg      1260
     gctttttctc tgatcattca cgaagcagtg gcgaatgcaa ttaaacatgc ctttgctccg      1320
     gggagaaaca acgttctgga gatccttgta cgcgagatta acaatacggt tgttttgtgc      1380
     ataaaagata atggtgcggg ctttccagct gaacttgatt ttgacggaaa gaatcatttg      1440
     ggacttttca tgataaagca gctggctaca caattacgcg gtgaatttgt attgaagaat      1500
     tgcgggtatg aaggttccgg tgctcagata acggtagaat ttcccctacc ggaagcccgc      1560
     tttgtggggc ttccggagga gaataataga gactatctgc gacgatag                   1608
//

If you have problems or comments...

PBIL Back to PBIL home page