(data stored in ACNUC7421 zone)

EMBL: CP002116.PE220

CP002116.PE220       Location/Qualifiers
FT   CDS_pept        complement(228238..229017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0223"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="COGs: COG1349 Transcriptional regulators of sugar
FT                   metabolism; InterPro IPR001034:IPR014036; KEGG:
FT                   cbt:CLH_0701 deoxyribose operon repressor; PFAM: regulatory
FT                   protein DeoR; SMART: regulatory protein DeoR; SPTR:
FT                   Transcriptional regulator, DeoR family; PFAM: Bacterial
FT                   regulatory proteins, deoR family; DeoR-like
FT                   helix-turn-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79380"
FT                   /db_xref="GOA:E1RA89"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA89"
FT                   /protein_id="ADK79380.1"
FT                   /translation="MGNKEKRLDALKKMIQLERSMKISEISDRLHVSPMTTRRDIEILA
FT                   QDGTVKVLHGVVVSNSGGMAGGLSDYMLAVAETRNIDEKKAIARHALNFVEEDDIIFID
FT                   AGSTTETFASMLPPDIRLTVVCYSINIFLAVASHKNIEVLLTGGHYSRKTTILELSQTS
FT                   PVLQHNRTRKAFISASGYHQRLGVTCAHQSECITKKAAMNNTAEAFLLMDSSKFDVVHS
FT                   CHFADIEQFSRIFTNESIPTEYHRLLKEKGITVDYVR"
     atgggcaaca aagaaaaacg tctggacgcg ttaaaaaaga tgatacaact cgaacgttcc        60
     atgaagatat cggaaatttc cgatcgcttg catgtttctc ccatgacaac gcgccgcgat       120
     atcgaaatcc ttgcccagga cggcaccgta aaggtacttc acggcgtcgt cgtttccaat       180
     tccggcggta tggcgggagg actgtcggat tatatgcttg ccgttgccga aactcgcaac       240
     atcgacgaaa aaaaggcaat tgcacgccat gctcttaact ttgtcgaaga agacgatatc       300
     atattcatcg acgccggctc tactaccgag acatttgcct caatgttgcc gcctgatatt       360
     cgattaaccg tcgtctgtta ttccatcaat atcttccttg cagttgccag ccacaaaaat       420
     atcgaggtgc ttctaacggg agggcattat agccgaaaaa ccactattct ggagctgagc       480
     cagacctcac cggtattgca acacaacaga acccgaaaag cattcatatc tgcaagcggc       540
     tatcaccaga gactgggtgt tacctgtgcc caccaaagcg agtgcataac caaaaaggct       600
     gcaatgaaca atactgccga agcctttctc cttatggatt cctccaaatt cgatgtcgtg       660
     cattcctgcc attttgccga tattgaacag ttctccagaa tctttaccaa tgaatcgatc       720
     ccgactgagt atcatcgcct cctgaaagaa aaaggaataa cagtagacta cgtaagatag       780
//

If you have problems or comments...

PBIL Back to PBIL home page