(data stored in ACNUC7421 zone)

EMBL: CP002116.PE221

CP002116.PE221       Location/Qualifiers
FT   CDS_pept        229146..229820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0224"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="COGs: COG0235 Ribulose-5-phosphate 4-epimerase and
FT                   related epimerase and aldolase; InterPro IPR001303; KEGG:
FT                   hor:Hore_18470 L-fuculose phosphate aldolase; PFAM: class
FT                   II aldolase/adducin family protein; SPTR: L-fuculose
FT                   phosphate aldolase; PFAM: Class II Aldolase and Adducin
FT                   N-terminal domain; TIGRFAM: L-ribulose-5-phosphate
FT                   4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79381"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA90"
FT                   /protein_id="ADK79381.1"
FT                   /translation="MGRVKQELKELIVSTGVEMIKTGITVGTWGNISYRDPETDYMYIS
FT                   PSGMDYMKVKTDHVVVMDLDLNIIEGEAEPSIEKHMHVAVYKARPDAHAVIHTHPTFST
FT                   VFGVAGLPLPAVSEDFVQIVGEEIAIASPYALPGTPELGEVAVKGLGKNGAVLLPGHGA
FT                   LIAAANMPMALKISTVLEKNAQIYLYAKLLGNGIRLFSREEIDAMQNFAKNHYGKKNQE
FT                   LV"
     atgggcagag taaagcagga gttaaaagag cttattgttt caactggtgt tgaaatgatt        60
     aagacgggta ttaccgtagg gacatggggg aacatcagct atcgagaccc tgagaccgat       120
     tatatgtaca tcagccccag cggtatggat tatatgaagg taaaaactga ccatgtcgtt       180
     gtcatggacc ttgatctgaa tattattgag ggtgaggcag agccttccat tgaaaagcat       240
     atgcacgttg cggtgtacaa ggcacgtccg gatgcccatg ctgttattca tacccatccg       300
     acgttttcca ccgtttttgg tgttgcgggt ttacccctgc ctgcggtaag cgaagatttt       360
     gttcagatcg tgggcgaaga gattgctatt gcttctccct atgccctgcc cggtactccc       420
     gagctgggag aggttgccgt gaagggtctc ggaaaaaatg gtgccgttct gcttcccggt       480
     catggtgctc tcattgccgc tgcgaacatg cctatggcac ttaagatcag tacggttctt       540
     gagaaaaatg cacagatata tctctatgcg aagttgttgg gtaatggcat ccgcctcttc       600
     tccagagaag agatcgatgc aatgcagaat tttgcaaaaa accattacgg caaaaaaaat       660
     caagaacttg tataa                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page