(data stored in ACNUC7421 zone)

EMBL: CP002116.PE222

CP002116.PE222       Location/Qualifiers
FT   CDS_pept        229964..230998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0225"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="COGs: COG1609 Transcriptional regulators; InterPro
FT                   IPR000843:IPR001761; KEGG: gka:GK2115 transcriptional
FT                   regulator; PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; SPTR: Putative uncharacterized
FT                   protein; PFAM: Bacterial regulatory proteins, lacI family;
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79382"
FT                   /db_xref="GOA:E1RA91"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA91"
FT                   /protein_id="ADK79382.1"
FT                   /translation="MSRYTITEFAKICGTSPATVSRVLNNPELVAAPLRKHVEEKMKEL
FT                   GYKPNPFASKLSSKSSWGLALFVFDILNPFFALIVRRISHLAMEQGIPLTICDTENNAD
FT                   KERIYLDYLLDNKIAGVIFAEGISLPTIERAQHYTETVLIDRHSQEGFVSEVSSDNYTG
FT                   GRQATEYLLQLNHQRIAFISGPENWPSVEDRFHGYRDALDAYGVPFHPELVYQGDLRYE
FT                   SGISAIEYFLTLPEWPTAIFSANDQMAYGAMSKARHLNIAIPEDISLVGFDDIPFHNFF
FT                   QANLTTVKQDIPALCENAFSILIGKVNNGSQGGIEKRVVVPTTLKIGDTCRKLVGSVKR
FT                   PAIR"
     atgagcaggt atactattac tgaatttgcg aaaatctgcg gaacctcgcc ggcaactgtt        60
     tcccgcgtgt tgaataaccc tgaattggtt gcggctcctt tgcgtaagca tgttgaggaa       120
     aaaatgaagg aattgggcta taaaccgaat ccttttgcct caaagcttag ttccaaatca       180
     agctgggggc ttgctctttt tgtcttcgac attctaaatc cgttttttgc cttaattgtc       240
     agaaggatta gtcatcttgc catggagcag gggattcctc ttacgatttg tgacaccgag       300
     aataatgcgg acaaggaacg aatttatctt gattacctat tggataataa aattgcgggt       360
     gtgatttttg ccgaaggtat atcccttcca accatcgagc gggctcagca ctataccgaa       420
     acggtcctga ttgatcgtca ttctcaggaa ggctttgtct ccgaagttag cagtgataac       480
     tataccggag gacgacaggc cacggaatat cttttgcagt tgaatcatca acggattgct       540
     tttatcagtg ggccggaaaa ctggccttcg gtagaagatc gctttcacgg atatcgcgat       600
     gcactcgatg catatggagt tccctttcat ccggaattgg tctatcaggg ggatttgcga       660
     tatgaatcgg gaatttccgc tattgagtat ttcctgacgc tgcccgaatg gcctaccgcc       720
     attttcagtg cgaatgatca aatggcctac ggtgccatga gcaaggctcg ccacttaaat       780
     attgccattc ccgaggatat ttctcttgtc ggctttgacg acattccgtt tcacaatttt       840
     tttcaggcca acttaacaac ggtgaaacag gatattcccg cattatgcga aaatgctttc       900
     tctattctta tcggcaaggt aaataatggt tcccaaggcg ggattgaaaa acgggttgtt       960
     gtaccaacga ccttaaaaat aggcgatacc tgtaggaagc tggtcggatc cgtcaaaagg      1020
     ccggcaattc gataa                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page