(data stored in ACNUC7421 zone)

EMBL: CP002116.PE223

CP002116.PE223       Location/Qualifiers
FT   CDS_pept        231015..231932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0226"
FT                   /product="glycyl-radical enzyme activating protein family"
FT                   /EC_number="1.97.1.4"
FT                   /note="COGs: COG1180 Pyruvate-formate lyase-activating
FT                   enzyme; InterProIPR012839:IPR007197:IPR001450:IPR017896:IPR
FT                   011352:IPR017900:IPR005829:IPR001989; KEGG: rpc:RPC_1176
FT                   glycyl-radical activating protein; PFAM: Radical SAM domain
FT                   protein; 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; PRIAM: [Formate-C-acetyltransferase]-activating
FT                   enzyme; SPTR: Glycyl-radical enzyme activating; TIGRFAM:
FT                   glycyl-radical enzyme activating protein family; PFAM:
FT                   Radical SAM superfamily; TIGRFAM: glycyl-radical enzyme
FT                   activating protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79383"
FT                   /db_xref="GOA:E1RA92"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR040074"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA92"
FT                   /protein_id="ADK79383.1"
FT                   /translation="MAENLTIFELERYALEDGPGIRTVVFFKGCNLHCLWCQNPESQQR
FT                   RPQVLYYRKQCVGCGKCIETCPAGAIDTASDLGFVTIHDRCTLCASCVDACFYNARRIA
FT                   GEVRSSEDIMREIMKDQSFYENSGGGVTFSGGEPLLQIEGLVDLASRCRSEGIHTALET
FT                   AGSVPWDRFERIFPYMNLIYFDVKHIDPLVHERVVGAPNGVILNNLIRLSREFEPVIVR
FT                   IPVIPGVNDSPEVIGDICSFLSTRTRVRKVELLPFHRLGSGKYAALGREDSMEGVPSLD
FT                   KAACLPLAGLGKRFGLDITVGAGH"
     gtggccgaga atctgacgat atttgaactt gagcgttatg ccctggagga tggccccggg        60
     atcaggacgg tcgtcttttt taagggatgt aatctgcatt gcctctggtg ccagaaccct       120
     gagtctcagc aacgtcggcc tcaggttctt tactatcgaa aacagtgtgt cggttgtgga       180
     aagtgtattg agacctgccc tgccggggca atagatacgg cttctgacct tggttttgtg       240
     acgattcacg accgctgcac gctttgtgcc agctgtgtgg atgcctgttt ttataatgca       300
     aggcgaattg ccggcgaagt ccgaagctcc gaggatatta tgcgggagat catgaaagac       360
     caaagctttt atgagaattc cggcggtggt gttacctttt ccggcggaga gcccttactg       420
     caaatcgagg ggcttgttga tcttgcctcc cgttgtcgct ccgagggaat ccatacggcg       480
     ttggaaacgg ctggtagtgt cccttgggat cgcttcgagc gtatttttcc ctatatgaat       540
     ctgatctatt ttgatgtgaa gcatatcgat cctctggtgc atgagcgtgt tgtcggtgca       600
     ccgaacggtg tcattctgaa taatctgatc aggctgagtc gtgaatttga gccagtcatt       660
     gtccgaatcc ctgtcattcc gggggtaaat gattcgcctg aggtaatagg ggatatctgc       720
     tcctttcttt ccacccgaac gagggtgcgg aaggtagaac ttctgccttt tcaccgattg       780
     ggatcgggaa aatatgcggc cctcggccgt gaggattcca tggagggcgt tccgagtttg       840
     gataaggctg cctgccttcc tcttgccgga cttggtaagc ggtttggtct tgatatcacc       900
     gtaggtgcgg ggcattga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page