(data stored in ACNUC7421 zone)

EMBL: CP002116.PE224

CP002116.PE224       Location/Qualifiers
FT   CDS_pept        231932..232858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0227"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_0934 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79384"
FT                   /db_xref="InterPro:IPR025117"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA93"
FT                   /protein_id="ADK79384.1"
FT                   /translation="MKGLALSKLFYHDRVLPSFREHFPDDISSMAFGLVGHGSECYGFD
FT                   DEFSRDHDWGARLCLWLPAGTPEEKIHAMEKLYRSLEGPFGGFGAVRRLDPAVGRDGVM
FT                   TVPFFFEHLIGSPSPPETIKEWMAMREEGLSLATNGDIFFDGSGEIGAFRESLNHYFPR
FT                   DLWLKKIASRCFAFSQYGQYNLSRALLRSDIPLLQYTRASALKEAAALFFLLRRRYRPY
FT                   YKWLFHALSLEGPEGELLARYINMAASLSDPGTLKESIEAIARFMVTQLEERGLSFACG
FT                   AFLQEYGFHITEMIETPWLRSGSQIIE"
     atgaaggggc ttgccctttc aaaacttttt tatcacgatc gggttttgcc ctcattccgg        60
     gaacatttcc ccgatgatat ttcttccatg gcctttggat tggttggcca tggttccgaa       120
     tgttacggtt ttgacgacga gttctcccgc gatcacgatt ggggtgctcg tctctgcctt       180
     tggcttcccg cgggaacgcc ggaggagaaa atccatgcta tggaaaagct ctatcgtagt       240
     cttgagggac ctttcggtgg ttttggggcg gtgcggcgtt tggatcccgc tgtgggcagg       300
     gatggtgtca tgaccgtgcc cttctttttt gaacacctga taggcagtcc gtcccctccg       360
     gagacgatca aggagtggat ggcaatgcga gaagaggggc tctcacttgc caccaatggt       420
     gatattttct tcgatggttc aggagagata ggtgcttttc gggagagtct gaaccattat       480
     ttccccaggg atctgtggtt gaaaaagatc gcctcccgct gttttgcctt tagccagtac       540
     ggacaataca atctgtcaag agcactgctt cggtccgata tcccgttgct ccaatataca       600
     cgggcctctg cgcttaagga ggccgccgcc ctcttttttt tacttcgtcg tcgttaccgg       660
     ccctactata aatggctctt ccatgcgctt tctctggagg ggccggaagg agagcttctt       720
     gcgcggtata tcaacatggc cgcctctctt tccgatccgg gaacgctcaa ggagtctatc       780
     gaggccatcg cccgtttcat ggttacccaa ttggaggagc gtggactttc ttttgcctgc       840
     ggagcctttt tacaggagta cggttttcac ataaccgaaa tgattgaaac cccttggtta       900
     cggagcggat cgcagattat tgagtaa                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page