(data stored in ACNUC7421 zone)

EMBL: CP002116.PE225

CP002116.PE225       Location/Qualifiers
FT   CDS_pept        232869..233420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0228"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dps:DP0584 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79385"
FT                   /db_xref="InterPro:IPR025191"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA94"
FT                   /protein_id="ADK79385.1"
FT                   /translation="MDQAQKRIIAEILDREVAMFLRVPARQEPSCRAHLDDMQLHRRGQ
FT                   FSVWSLSCCESYLRDLRRAEEEGRNLMTIKYARMEDLIPPVSQSKRIPEIVSRFVGWQR
FT                   EMLSHYPNIMRGGRDIDDFANYLRCELETYSDATLELLWKDVDAFSRKKQNMSKAIYEF
FT                   LARQSGYTNIDEMEKRLKKS"
     atggatcaag cccaaaaacg tattattgca gaaattcttg atagggaagt ggccatgttt        60
     ttgcgagttc ccgcacggca agagccttct tgcagggctc atcttgatga catgcagtta       120
     catcggcggg ggcaattctc tgtctggtcg ctttcctgtt gtgagagcta ccttcgggac       180
     cttcggcggg cggaggagga aggacgaaat cttatgacga taaagtatgc gagaatggaa       240
     gacctcatcc ctccggtaag ccagagcaag cggatccctg agattgtttc cagatttgta       300
     ggttggcaac gcgagatgct ctcccattat ccgaatatca tgcgaggcgg ccgcgatatc       360
     gatgattttg caaattatct tagatgcgaa ttggaaacct attccgatgc cactcttgaa       420
     ctactttgga aggatgtcga cgctttttca cggaaaaagc aaaatatgtc aaaagcgatc       480
     tatgaattcc tggcccgtca gtcgggctac acgaatatcg acgagatgga aaaacgactt       540
     aaaaaatcgt aa                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page