(data stored in ACNUC7421 zone)

EMBL: CP002116.PE226

CP002116.PE226       Location/Qualifiers
FT   CDS_pept        233632..234588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0229"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="COGs: COG1879 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR001761; KEGG:
FT                   monosacharide ABC transporter periplasmic
FT                   monosacharide-binding protein; PFAM: periplasmic binding
FT                   protein/LacI transcriptional regulator; SPTR: ABC
FT                   transporter, periplasmic sugar binding protein; PFAM:
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79386"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA95"
FT                   /protein_id="ADK79386.1"
FT                   /translation="MSKKLLVLVLTAMLIPAGFLFSAGQQDGGEASNLMVIITPDKDNT
FT                   FFTAEADAAKAKAESLGYTTLLAVHGDDPKKEGDIIDTAIARKAVAIIIDVANADASPN
FT                   NLKRATDAGIPVFCMDREINATGIAKAQLISNNFQGAKLGGEYFVQVMGEKGNYVELVG
FT                   KESDTNAGVRSKGFHNIIDQYPDMKMVARQTANWSQTEGYSVIESVLQANPEVNGIICG
FT                   NDTMALGAQAAIDAAGRSDIIVIGFDGNDNVLDSIMEGKIEGTVMQPNAKNAEMAVELA
FT                   DTYIKTGSTGLDEEKILNDCFLITKENASQWRGFRKK"
     atgtccaaaa aactactggt tctggtactg accgccatgc ttatccctgc aggttttctt        60
     ttcagtgcgg gtcagcagga tggaggcgag gcttccaact taatggtgat tattaccccc       120
     gacaaagaca acaccttttt cactgctgag gccgatgctg cgaaggcgaa ggccgagtct       180
     ctcggttaca caacactttt ggccgtccat ggcgacgatc ccaagaagga aggcgatatt       240
     atcgatacgg caattgcaag aaaggccgtc gcgatcatta tcgatgtcgc aaatgccgat       300
     gcttccccga acaatttgaa gcgggctacg gatgcgggaa ttcccgtttt ctgcatggac       360
     cgggagatta atgccaccgg gattgccaag gctcaattga tttccaacaa cttccagggt       420
     gcaaaacttg gcggcgaata tttcgtccag gttatgggtg aaaaaggaaa ttatgtcgaa       480
     ctggtcggta aggaatcaga caccaatgcc ggtgttcgtt caaaaggctt ccacaatatt       540
     attgatcaat atcccgacat gaaaatggtt gccaggcaga cagcaaactg gagtcagacc       600
     gaaggttatt cggtcataga atcggtcctt caggcaaatc ccgaggttaa cggcattatc       660
     tgtggaaacg acactatggc cctcggcgcg caggctgcca ttgatgccgc cggcagaagc       720
     gacatcatcg ttattggatt cgacggaaac gataacgtac tcgattccat catggaagga       780
     aagattgaag ggacagtcat gcagccgaat gccaagaatg cggaaatggc agtggaactt       840
     gcggacacct acattaaaac tgggtcgaca ggccttgatg aagagaaaat actgaacgac       900
     tgtttcttga ttaccaagga aaatgccagt cagtggcgcg gtttccgcaa aaaatag          957
//

If you have problems or comments...

PBIL Back to PBIL home page