(data stored in ACNUC7421 zone)

EMBL: CP002116.PE228

CP002116.PE228       Location/Qualifiers
FT   CDS_pept        235382..236935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0231"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1129 ABC-type sugar transport system ATPase
FT                   component; InterPro IPR003593:IPR003439:IPR017871; KEGG:
FT                   mlo:mll7012 ribose ABC transporter, ATP-binding protein;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase; SPTR: ABC
FT                   transporter related protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79388"
FT                   /db_xref="GOA:E1RA97"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA97"
FT                   /protein_id="ADK79388.1"
FT                   /translation="MAEEQSEVVLEARNITKVFPGTRALQGVDFKVYKGKINVLVGENG
FT                   AGKSTLMKILAGIEEATSGTICLFDNEGTPHEVTLSSARDAAGKGIGIVHQELNLFTNL
FT                   NVAENIFMNKELSRHHSLYIDHQEQVERSRTILKRLGQDIDPETLVRDLRLGQQQIVEI
FT                   AKTMIDEPKILIMDEPTSSLSIQEVRVLFNVIADLKAQGVGIIYISHRLEEIREIGDYI
FT                   TILRDSKLVDCGLVAEMEMADIIRKMVGRDPKKFFSGQAHEAGKELLSVKHMTLPRFGG
FT                   GYTFQDVSLSVCEGEILGIYGLMGAGRTELLETMMGLYDKASGEITLEGQRLDTMDTKE
FT                   RIEHGLVLIPEERQREGLFLNLSVEKNLTMASIARYLKLWQINVKVEMKRVAEMIKEMV
FT                   IKVSSPSISINALSGGNQQKVVIGKALLTKPKVLLMDEPTRGIDVGAKSDVFEIMNKMA
FT                   KGKFGIVFVSSELEEIFSMSDRIIVLSKGKITGEFDRSEATEEKIRKASEIGHGITASA
FT                   "
     atggcagaag aacaaagcga agtagtgctg gaggctcgta acattacgaa ggtgttccct        60
     gggaccagag ccctgcaagg cgtcgatttt aaggtctata aggggaaaat caacgttctt       120
     gtcggagaaa acggtgccgg gaaatcgaca ctgatgaaga ttcttgcggg aatcgaggag       180
     gcgaccagtg ggacgatctg tcttttcgac aacgagggaa cgccccatga ggtgactctt       240
     tcatcggcac gggatgctgc ggggaaaggg atcggtattg ttcatcagga attgaatctc       300
     tttaccaatc tcaacgttgc cgaaaacatc tttatgaaca aggaactgag taggcatcac       360
     agcctataca tcgatcacca ggaacaggtc gaacgttcca ggacgattct caaacggctc       420
     gggcaggata tcgatcctga aactttggta agagatttgc ggcttggaca gcagcagatt       480
     gtcgagattg ccaagaccat gatagatgag cccaagatcc tgatcatgga cgaaccaact       540
     tcttccctga gcatccagga ggtccgggtt ctttttaatg ttatagcgga cctgaaggct       600
     cagggagtag gtattatcta tatcagccat cgattggaag aaattcggga aattggcgat       660
     tacatcacta ttctgcggga ttccaaactt gtcgattgcg gcctcgttgc cgagatggag       720
     atggccgata tcattcggaa gatggtcggc cgtgatccga agaaattttt cagcggacag       780
     gcacacgaag ccgggaaaga gcttttgtcg gtgaagcata tgacccttcc ccgtttcggg       840
     ggaggctata catttcaaga tgtctccctc tcggtatgcg aaggtgagat cctcggcata       900
     tacggtctca tgggggccgg gagaaccgag ctgcttgaga ccatgatggg cctttacgat       960
     aaggcctccg gtgaaattac cttggagggg caacggctcg ataccatgga cacgaaggaa      1020
     aggattgagc acgggcttgt cctgattccg gaggagcggc agagggaagg actcttttta      1080
     aatctttcgg tggagaaaaa cctcacgatg gcaagtattg cccggtatct gaagctttgg      1140
     cagatcaatg tgaaggtgga aatgaaacgt gttgccgaga tgattaaaga gatggtcatc      1200
     aaggtttcct ctccgtcgat ttcaataaat gctctgagcg gaggaaacca gcagaaggta      1260
     gtcatcggaa aggctctttt gacaaagccg aaggttcttc tgatggacga accaactcga      1320
     ggaatagatg tcggcgcaaa gtccgacgtc ttcgagatca tgaataaaat ggcaaagggc      1380
     aaattcggta ttgtatttgt atcatcggaa ctcgaagaaa ttttttccat gtcggatcgc      1440
     atcattgtgc tttcaaaagg aaagataacc ggcgagttcg accgctccga agcgacggaa      1500
     gaaaagatta gaaaggcttc ggagattggt catggaatca ccgcgtcagc gtag            1554
//

If you have problems or comments...

PBIL Back to PBIL home page