(data stored in ACNUC7421 zone)

EMBL: CP002116.PE229

CP002116.PE229       Location/Qualifiers
FT   CDS_pept        236913..238043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0232"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG1172 Ribose/xylose/arabinose/galactoside
FT                   ABC-type transport systems permease components; InterPro
FT                   IPR001851; KEGG: sme:SM_b20352 sugar ABC transporter
FT                   permease protein; PFAM: inner-membrane translocator; SPTR:
FT                   ABC transporter, permease; PFAM: Branched-chain amino acid
FT                   transport system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79389"
FT                   /db_xref="GOA:E1RA98"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA98"
FT                   /protein_id="ADK79389.1"
FT                   /translation="MESPRQRSTGRLKKRFMTALANKKPGTGFSIGMLVLKLRTLIAFL
FT                   AVLIVFSFIAPNFLSITNLIAMAKHSAIWAILAVGMTYVIIGGGIDLSIGSIVGLCGMI
FT                   AGGLIAEGLRLPIFGIVIYFNVPMIILIVLLIGVLLGAVNGLIITKLGVAPFIATLGML
FT                   YMGRGFAMLRSGGKTFPNLIGNPALGNTGFPILGAGTMLGIPLVVWIAAVIAIIAAYVS
FT                   QKTPFGRHIYAVGGNEDAAVLSGIRVNRLKMAIFMFSGFTAALTGLVLASQLVASHPAT
FT                   GEAYEMTAIAAVVLGGASLNGGRGSIGGTIIGALILGVLNDGLVMIGVSSFWQTAIKGM
FT                   VLVLAVVIDQYQLRKQNEAALHQQQADEKGPEKVSA"
     atggaatcac cgcgtcagcg tagcacaggg aggttgaaaa agcgttttat gacagcttta        60
     gctaataaaa aaccggggac cggtttttcc attgggatgt tggtattgaa actgaggact       120
     ttaatcgctt ttcttgcggt actgatagtc ttctctttta ttgctccgaa ttttctgtcg       180
     attaccaatt tgattgccat ggcgaaacat tccgccatat gggcgatcct tgcggtggga       240
     atgacctacg ttatcattgg cgggggaatc gacctttcga taggctccat cgtggggctc       300
     tgtggaatga tcgccggcgg tttgattgcc gaaggtctca ggcttccgat attcgggatc       360
     gtgatctatt tcaacgttcc catgatcatc ttgattgttc tgcttattgg tgtattgctt       420
     ggtgctgtca atggtttgat catcactaag cttggggttg caccatttat cgccactttg       480
     ggaatgcttt acatgggaag aggtttcgcc atgcttcgtt ccggcggaaa gacctttccc       540
     aatcttatcg ggaatcccgc tctcggtaat acaggctttc ctattcttgg ggcaggaacc       600
     atgttaggca ttccgcttgt cgtctggatc gccgccgtca ttgccatcat cgccgcttat       660
     gtatcccaga aaaccccatt cgggcgtcat atctatgctg tcggcggaaa tgaagatgca       720
     gcagtcctgt cgggaattcg agtcaatcgg ctgaaaatgg ccatcttcat gttttccggt       780
     tttaccgcgg cccttacggg acttgtcctt gcatctcagc ttgtggcctc ccacccggca       840
     acaggtgagg cttacgagat gacagctata gcggcagttg tcctgggtgg agcttcgtta       900
     aatggcggcc gaggatccat cggcggcacc atcatcggtg cccttatcct cggagtattg       960
     aacgacggct tggtcatgat cggtgtctct tccttctggc aaaccgccat caagggaatg      1020
     gtcttggttc ttgccgtagt tattgatcag tatcaattga gaaaacagaa tgaggctgca      1080
     ttgcaccaac agcaggctga tgaaaagggt cctgagaaag taagtgctta g               1131
//

If you have problems or comments...

PBIL Back to PBIL home page