(data stored in ACNUC7421 zone)

EMBL: CP002116.PE23

CP002116.PE23        Location/Qualifiers
FT   CDS_pept        complement(19760..20260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0023"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppu:PP_0636 cold shock DNA-binding
FT                   domain-containing protein; SPTR: Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79183"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6Q1"
FT                   /protein_id="ADK79183.1"
FT                   /translation="MKKYTIMFIIAAGMVFSSGSTLFAEGAQEDEDFRDNPYQTVTVSG
FT                   KIYASFSGFPELKGDDGKTYRLMFPMFLADSLELSNGESVSVEGFSAPANWRPTRNPSD
FT                   AVYLRLVKATIDGQTYDLSRFYGHMGPGGPGRFHEGWGCFESGYDDSNHMVPAPGMGGY
FT                   RRR"
     atgaaaaaat acacgattat gttcattatt gctgctggaa tggttttttc ttccggctct        60
     accctttttg cagagggggc ccaggaagat gaagactttc gggataatcc ctaccaaaca       120
     gtaaccgtaa gcggaaagat ctatgcaagt ttttcaggct ttcccgagtt gaaaggagac       180
     gacggaaaaa cctaccgctt gatgttcccc atgtttcttg cagacagtct tgaactttcc       240
     aatggagaaa gcgtaagtgt agaaggattt tctgctcccg caaactggcg gccgacaaga       300
     aatcccagtg atgcggtcta tcttcgcttg gtgaaagcga ccatagacgg tcagacctac       360
     gacctttccc gcttctacgg ccatatgggt cccggaggtc ccggaaggtt ccatgaggga       420
     tggggctgtt tcgaatcagg ttacgatgat tcgaaccata tggtacctgc gcctggaatg       480
     ggaggctatc gtcgcagata g                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page