(data stored in ACNUC7421 zone)

EMBL: CP002116.PE231

CP002116.PE231       Location/Qualifiers
FT   CDS_pept        239390..240028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0234"
FT                   /product="YheO domain protein"
FT                   /note="COGs: COG2964 conserved hypothetical protein;
FT                   InterPro IPR013559; KEGG: aoe:Clos_1744 YheO
FT                   domain-containing protein; PFAM: YheO domain protein; SPTR:
FT                   Putative uncharacterized protein; manually curated; PFAM:
FT                   YheO-like PAS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79391"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAA0"
FT                   /protein_id="ADK79391.1"
FT                   /translation="MNKNEAFEFLNRLAAGIAKTFGNSCETVVHDMNNKKHSILVIYNG
FT                   HVTKRKIGGGLDLLGTNKQINDFLSNGSDLINCDGRSANGKQIKSTTLHLQGDNYHYAL
FT                   GINFDYTLLSVAENAIKELTRVGENLEAAVKESGENRLKDIFKECVTILGKPVAIMNKD
FT                   DRMRIVALLQERNAFSFQKSIPCISAWLHISRYTIYNYLKEINEKQRTG"
     atgaataaga atgaagcctt tgaattttta aacaggttgg cggcaggcat agcaaagacc        60
     tttgggaatt catgtgaaac tgttgttcac gatatgaata ataaaaaaca ttccatcctc       120
     gttatctata atgggcatgt taccaaaagg aagattgggg gagggcttga cctccttggg       180
     accaataaac aaatcaatga ttttcttagc aatggcagcg acttgataaa ttgcgacgga       240
     aggagtgcaa acgggaaaca gatcaagagt acaacactgc acttgcaggg tgataattat       300
     cattatgctc tcggtattaa ttttgattat acgctgcttt cagttgcaga aaatgcgatc       360
     aaggagctta ccagggtggg agagaacctt gaagcggctg tgaaagaatc tggcgaaaac       420
     agattgaaag acatatttaa agagtgtgtt accatacttg gcaagcctgt cgctataatg       480
     aataaggacg acagaatgcg aatagttgct cttcttcagg agagaaatgc gttctcgttt       540
     caaaaaagta ttccctgtat ttccgcatgg ctccacatat caagatatac tatctataac       600
     tatttgaaag agattaacga aaaacaaaga actggatga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page