(data stored in ACNUC7421 zone)

EMBL: CP002116.PE232

CP002116.PE232       Location/Qualifiers
FT   CDS_pept        complement(240080..240751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0235"
FT                   /product="YheO domain protein"
FT                   /note="COGs: COG2964 conserved hypothetical protein;
FT                   InterPro IPR013559; KEGG: dvl:Dvul_1030 YheO
FT                   domain-containing protein; PFAM: YheO domain protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: YheO-like PAS
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79392"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAA1"
FT                   /protein_id="ADK79392.1"
FT                   /translation="MRDTIRNYLPIVQFLGSVLGSYYEIILIELKDEGSGIVAIENSHI
FT                   SGRKIGDGLTDLCLRFIKEETYKDTSFKSNYTCISNGRKLRGSTYFIKEGDMLVGMLCI
FT                   NFDTETFIELDTRLLQFANIQAQGIIDTLFPPQGVPDNNTETVLSSVTELCEQEVRKYA
FT                   EKNKLDAKKFTQENRIEIIEHLNNLGIFLIKGIVPDVANLIGTSEASVYRYLSIVNRKK
FT                   K"
     atgcgtgata cgatacgaaa ctacctacca attgtacagt ttctaggatc ggtactcggc        60
     agctactatg aaatcatact catcgaacta aaagatgaag gcagcggtat cgtcgcaata       120
     gaaaattcac atattagcgg aagaaaaatt ggtgacgggc ttaccgacct ctgcctcaga       180
     ttcattaaag aggaaaccta taaagatacc agtttcaaaa gtaattacac gtgcatctcc       240
     aatggaagaa agctccgagg ttctacgtat tttataaaag aaggtgatat gctggtagga       300
     atgctttgca ttaatttcga tacagaaacc tttattgaac tcgatacgcg actactacaa       360
     tttgccaata tacaggcaca gggaataatc gacacgctgt tcccccctca aggtgtacca       420
     gataacaaca cggaaacagt cctctcctcg gtaacagagc tatgtgaaca agaagtcaga       480
     aaatacgcag agaaaaataa actcgatgca aaaaaattca cccaggaaaa caggatagaa       540
     ataatcgaac acctcaataa tttgggcatt ttcctcatca aagggatcgt acccgatgta       600
     gcaaacctta ttggaacttc ggaggcaagc gtttatcgct acctaagcat tgtcaacaga       660
     aagaaaaaat ag                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page