(data stored in ACNUC7421 zone)

EMBL: CP002116.PE234

CP002116.PE234       Location/Qualifiers
FT   CDS_pept        242546..244480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0237"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="COGs: COG1053 Succinate dehydrogenase/fumarate
FT                   reductase flavoprotein subunit; InterPro IPR006076; KEGG:
FT                   str:Sterm_3522 FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; PFAM: FAD dependent oxidoreductase; SPTR:
FT                   Predicted protein; PFAM: domain; FAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79394"
FT                   /db_xref="GOA:E1RAA3"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAA3"
FT                   /protein_id="ADK79394.1"
FT                   /translation="MFSMKWPYPIECNQEERVKTDVLVIGGGISGCMAAISAAKQGAKV
FT                   ALLEKGATIRSGAGGSGCDHWESATTNPCSTVSPEEITQAMIDDNDGYNNGISHYIECR
FT                   EGWDCLREIEKMGGKIRDTEDEFLGADFRDPETKLMFAYDLKNKFTIRIWGSTFKPVLY
FT                   KELKRLGVKIYDRIMVTSLLTEGGEIGKRVIGCTGFHVRTGKHLVVSSKATVLATSRPA
FT                   RIWLFSPAYPGLCEFRPTQCVGDGHAMGWRAGAAFSMMEKSVTAEFSAAGRSFPPYGTG
FT                   NNHNTWYPASMCDARGKPIPYLDRDGKELKEFSDRYRPAAGQQYFLKGGSIDYPKYEYD
FT                   GPETIDQKKLLSMGYKLPFYADLTTMPELERKAIWGMMVGEEGKTKIPIYQNYTERGFD
FT                   PTRHVLQAYGGGWKSASFLPQERQLFGLPGGFLNDWNLATNLEGLFVAGDALFASNCFG
FT                   HAAATGSYAGRHASAYAKNVQHLVPCEKQIAKERSRTYASLGAEGQERYSWKELNMAIA
FT                   KTMQNYCGDPKCDDLLETGLDVFRHYETNILPHLYSRNPHELMRTLEVENILTNAQIIL
FT                   RSCLQRKSSSRALCFNRADYPEMDPERDRRFFTIRLTKSGVDMGSVPLRYYGDLSRNYE
FT                   KYNGNYIAE"
     atgttttcta tgaagtggcc ctatcccata gaatgtaatc aggaagagcg ggttaaaacc        60
     gatgtactag tcatcggcgg tggaatatcc gggtgtatgg ccgctatctc tgcagcaaaa       120
     cagggagcga aggtagcact tctggaaaaa ggtgcaacca taagaagcgg cgccggtgga       180
     tcgggctgtg atcactggga atcggctaca acgaaccctt gcagcacggt tagtccggag       240
     gagatcaccc aggctatgat cgatgataat gatgggtata ataatggaat ttctcattat       300
     atcgaatgcc gggaaggatg ggattgtctc cgggagatcg aaaaaatggg agggaaaatt       360
     cgggataccg aggatgaatt tctcggggcg gatttccgtg atccggaaac caaattgatg       420
     tttgcgtatg atctaaagaa taaatttacc attcgaattt ggggatctac cttcaagcct       480
     gttttgtaca aagaattaaa gcgtcttggt gtaaaaatat acgaccggat tatggttacg       540
     tctcttctga cagaaggcgg agaaatcggt aagcgtgtca taggctgtac aggctttcat       600
     gttcgtaccg gaaagcatct ggttgtttcc tctaaggcca ctgtccttgc cacctcccgt       660
     cccgcaagaa tttggctgtt ttcccctgca tacccgggcc tttgtgaatt cagaccgacc       720
     cagtgtgtcg gagatggaca tgccatggga tggcgagccg gtgcggcgtt ttcgatgatg       780
     gaaaagtcgg taaccgcaga gttctctgca gcggggagga gtttcccccc ctatggtacg       840
     ggtaataacc acaatacctg gtatcctgct tccatgtgtg atgccagagg aaagccaatt       900
     ccctatctcg acagagacgg taaggagtta aaagaattca gcgaccgcta tcgtcctgct       960
     gccggtcaac agtactttct caaaggtgga tccattgatt acccgaagta tgagtacgat      1020
     ggaccggaga ccatagacca aaagaagctc ctttcgatgg ggtataagct cccattctat      1080
     gctgacctca ccacgatgcc cgaactggaa cgaaaggcca tctggggcat gatggtggga      1140
     gaagagggaa agacaaagat ccccatttat caaaactata ctgaacgtgg gtttgacccc      1200
     acccgtcatg ttctgcaggc gtatggaggt ggatggaaat ctgcatcgtt tcttccccag      1260
     gaacgacagc tattcggatt gcctggcggt ttcctgaatg actggaattt agcaacaaat      1320
     cttgagggcc tttttgtagc tggcgacgca ctttttgcct ccaactgttt cggtcatgct      1380
     gcggccacag gaagctatgc cggacgccac gcttcagcat atgcaaagaa cgtccagcac      1440
     ctcgttcctt gtgaaaagca gatagcgaag gagcggagtc gaacatatgc gtccctcggt      1500
     gcggaagggc aagaacggta ttcctggaaa gagctcaata tggctatagc caagacgatg      1560
     caaaactatt gtggtgatcc taaatgcgac gatctcttgg aaacaggctt agatgtcttt      1620
     cggcactatg agaccaacat ccttcctcat ctctattcaa ggaatcctca tgagctcatg      1680
     aggaccctcg aggtcgaaaa catacttacg aatgcccaga tcatccttag atcctgctta      1740
     caacggaaat caagttcaag ggctctctgc tttaacaggg ccgattatcc ggaaatggac      1800
     ccggaacggg atcgaaggtt ctttaccata cgattgacca agtccggggt ggatatgggt      1860
     tcggtccccc tgagatatta tggagatctt tctcggaact atgagaaata caatgggaac      1920
     tatatagcgg agtaa                                                       1935
//

If you have problems or comments...

PBIL Back to PBIL home page