(data stored in ACNUC7421 zone)

EMBL: CP002116.PE235

CP002116.PE235       Location/Qualifiers
FT   CDS_pept        244485..244781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0238"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="InterPro IPR001450:IPR017896:IPR017900; KEGG:
FT                   ckr:CKR_2705 hypothetical protein; PFAM: 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; SPTR: Predicted
FT                   protein; PFAM: 4Fe-4S binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79395"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAA4"
FT                   /protein_id="ADK79395.1"
FT                   /translation="MNIENICAGPDIASIEPISFNTERCIACNRCADVCQVDVLVPSLE
FT                   KGKPPLVLFPGECWYCGCCVMECPTHAIQLRHPLMNQAHFRLKKELEDTLESE"
     atgaatatag aaaatatatg tgcaggcccg gatattgcat caattgaacc catctccttt        60
     aataccgaac gatgcatagc ttgtaacaga tgtgccgatg tgtgtcaggt tgatgtactt       120
     gttccttctc tggaaaaggg caagccccca cttgtcctct tcccgggtga atgctggtac       180
     tgtggctgtt gtgtcatgga gtgtcccact catgcaatac agcttcggca tcctctgatg       240
     aaccaggcgc attttcggct gaaaaaggaa ttggaagata ccttggaaag cgaataa          297
//

If you have problems or comments...

PBIL Back to PBIL home page