(data stored in ACNUC7421 zone)

EMBL: CP002116.PE238

CP002116.PE238       Location/Qualifiers
FT   CDS_pept        247587..248948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0241"
FT                   /product="DNA photolyase FAD-binding protein"
FT                   /note="COGs: COG0415 Deoxyribodipyrimidine photolyase;
FT                   InterPro IPR006050:IPR005101:IPR008148; KEGG: hmo:HM1_1861
FT                   deoxyribodipyrimidine photolyase; PFAM: DNA photolyase
FT                   FAD-binding; DNA photolyase domain protein; SPTR:
FT                   Deoxyribodipyrimidine photolyase; manually curated; PFAM:
FT                   FAD binding domain of DNA photolyase; DNA photolyase;
FT                   TIGRFAM: photolyase PhrII"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79398"
FT                   /db_xref="GOA:E1RAA7"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR032673"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAA7"
FT                   /protein_id="ADK79398.1"
FT                   /translation="MIQNERLFLLKKGECNEKGAYVLYWMQQSQRSRYNHALEYALGEA
FT                   NRRSLPLLVLFVVSRDYLGAGRRHYRFLLEGIEQLEVDLADRGIGFLLKIGDPPGIVAE
FT                   FAADAALVVFDTGYTRLQRSWRKAAAAGSFCAPVMEVESDLVVPVRTASGKEEYSAATI
FT                   RRKITPLLFRFMQPLKRQSAKIDSTALAGRADGLDSKAAEELLRFSQPEVEPVSWIHGG
FT                   SVEAHRRLDAFITSGTLERFHEERNDPSKEGLSCMSPYLHYGQISALEIALRASEHPGP
FT                   GCEAFLEELIIRRELAFNFVFYNRFYDSFEALPRWAREDLEAHEGDKREVLYDDAQLEE
FT                   AKTHDPYWNAAQRELTHKGKMHGYMRMYWGKKILEWSASPREAFERALRLNDRYSLDGR
FT                   DPNGYTGVAWCFGKHDRPWASRPVFGKIRYMNDRGLERKFDIASYVKQVQKSCE"
     atgatacaaa atgaacgctt atttcttcta aagaagggtg aatgcaacga gaaaggggcc        60
     tatgtcctct attggatgca gcagagtcag cgttcccgct ataaccatgc ccttgaatat       120
     gccctcggtg aggcaaacag acgttcgctg ccacttcttg tgctttttgt cgtgagccgg       180
     gactatcttg gtgccggtag gaggcattat cgttttctct tggagggaat cgagcagctt       240
     gaagtggatt tggccgatcg gggaatcggt tttcttctta aaatagggga tccgccggga       300
     attgttgccg aattcgcggc cgatgcggca ctcgttgtct tcgacactgg ctatacgcgc       360
     cttcaacgta gctggcgaaa ggctgcggcg gccggttcct tttgcgctcc ggtgatggag       420
     gtcgagagtg atctggtcgt tcctgtgcgg actgcaagtg gcaaagagga gtattctgct       480
     gccacgatac gaagaaagat aacccctctc ctttttcgct tcatgcagcc ccttaaacgg       540
     cagtcggcaa aaatcgattc gactgctctt gccggaaggg cagatggtct ggatagtaag       600
     gcggccgagg aactcctcag gttttcccaa cccgaggttg agcccgtctc ctggattcac       660
     ggcggcagcg ttgaggcgca tcgacgtttg gacgcgttta tcacttcggg tacgttggaa       720
     cgctttcacg aggaacggaa cgatccctca aaagaggggc tttcctgcat gagtccctat       780
     cttcattacg gacagatttc cgccctggaa atcgccctac gtgcctcgga gcatccgggg       840
     ccgggatgtg aagcattcct agaagagctg attatccgcc gggagcttgc ctttaatttt       900
     gtcttctaca accgattcta cgatagcttt gaggcccttc cccgatgggc gcgggaggat       960
     cttgaggccc acgaagggga caagagggaa gttctctacg acgacgccca gcttgaagag      1020
     gcgaagacgc acgatcccta ttggaatgcg gcccaacgtg agttgacgca taaagggaag      1080
     atgcacggct atatgaggat gtattgggga aagaagatcc ttgaatggtc agcttctccc      1140
     agggaggcct ttgagcgggc cctgcgtctc aacgaccgct attccctcga tggccgtgat      1200
     cccaacggct acaccggggt tgcatggtgc ttcggaaagc atgatcgtcc ctgggcctcg      1260
     cggccggtat tcggaaagat tcggtacatg aatgatcgcg gccttgagcg caaattcgat      1320
     attgcttcct atgtaaaaca ggtgcaaaaa tcgtgtgagt ag                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page