(data stored in ACNUC7421 zone)

EMBL: CP002116.PE24

CP002116.PE24        Location/Qualifiers
FT   CDS_pept        20456..21319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0024"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="COGs: COG1737 Transcriptional regulators; InterPro
FT                   IPR000281:IPR001347; KEGG: cdl:CDR20291_1955 RpiR-family
FT                   transcriptional regulator; PFAM: helix-turn-helix protein
FT                   RpiR; sugar isomerase (SIS); SPTR: Putative uncharacterized
FT                   protein; PFAM: Helix-turn-helix domain, rpiR family; SIS
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79184"
FT                   /db_xref="GOA:E1R6Q2"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6Q2"
FT                   /protein_id="ADK79184.1"
FT                   /translation="MDILEQIKSEYPNYNSTRKRIASFILENPTRCCFLSLKEFAEEAR
FT                   STEVTVLNFCRSLGLGRYVELKKALQSHVLIWTRPADRMKALASRSSDSNELFDQVVKS
FT                   EQKALRSTFEHNGPKQILSFIQMIRKARRVFVAAHGASRIFSSVITYRLSLLGVDISEL
FT                   DMDNPHKTIFRLLSCNPEESLLIAIATPPYGKNTIATTRMCRSRGISVVTITDSTLSPL
FT                   VSMAETALICPTELMGLTNSPTSIMAIIDIIAVLFLAEKQEDEFSHQEDLAQQYEHYLK
FT                   LFNSEL"
     atggacatcc ttgaacagat caaaagtgag tatcccaact acaacagcac cagaaagcgt        60
     attgcttcat ttattttgga aaatccgact cgctgctgtt ttctctcttt gaaggaattt       120
     gctgaagagg ctcgttctac cgaggtcacc gttctcaatt tttgccgttc tctggggctc       180
     ggacgttatg tcgaactaaa aaaagctctg caatcgcatg tattaatctg gacaaggccc       240
     gcggatcgaa tgaaggccct tgcaagtcga agcagcgaca gtaacgaatt gttcgaccag       300
     gttgttaagt cggaacagaa ggccctgcga tcgacctttg agcataacgg tcccaaacaa       360
     attctttcct tcattcagat gatacggaag gcccgtcggg tttttgtagc cgcacatggt       420
     gcaagtcgta ttttttcttc ggttattacc tataggctct cgcttttggg ggtagatatc       480
     agtgaattgg atatggataa tccccacaaa acgatttttc ggctgctaag ttgtaatcca       540
     gaagagagtc ttttaatcgc tatagcaact cctccttacg ggaaaaatac cattgcaact       600
     acccgtatgt gtcggtcccg ggggatttcc gtggttacca ttaccgacag taccctttcg       660
     cccttggttt ccatggctga gaccgcactg atctgcccga cggaattgat ggggctcacc       720
     aattctccca cctctattat ggcgatcata gatatcattg ccgtactctt ccttgctgag       780
     aaacaggagg acgaattctc ccaccaagag gatcttgccc agcaatacga acattacctt       840
     aagttgttca atagcgaatt gtag                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page