(data stored in ACNUC7421 zone)

EMBL: CP002116.PE240

CP002116.PE240       Location/Qualifiers
FT   CDS_pept        249848..250885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0243"
FT                   /product="phosphoesterase RecJ domain protein"
FT                   /note="COGs: COG0618 Exopolyphosphatase-related protein;
FT                   InterPro IPR001667; KEGG: gem:GM21_1931 phosphoesterase
FT                   RecJ domain protein; PFAM: phosphoesterase RecJ domain
FT                   protein; SPTR: Phosphoesterase RecJ domain protein; PFAM:
FT                   DHH family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79400"
FT                   /db_xref="GOA:E1RAA9"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAA9"
FT                   /protein_id="ADK79400.1"
FT                   /translation="MENSKDALEKLGSVVSGKKELLILTHTHPDPDAIAAAVALRLLLK
FT                   ELFHVGASIAYSGIIARAENRAMVKKLNLPLKQYSRIKLSRYDGIALVDSQPGAGNNVL
FT                   DASSPCDIVIDHHPRRDDTKGAFVVIEPELGASATMLIEWLDAAGVDLSADIATALAYA
FT                   ISSETQNMYREAARRDIRAYLSVYVRASIRKLAGIINANLPHYYFLQLGDAINNALMFG
FT                   TMITTHLDEIRHPEIVAEMADFLLKHERIGTVLVSGRFRNHLIISIRTRSEGINAGRLI
FT                   KQLPLDPDNVGGHDRTAGGFFDLHGKDRKEVEEINITIRNAFAALLGYENPSWRKLLDQ
FT                   VPRKS"
     atggaaaata gtaaggatgc tctggagaaa cttggttccg ttgtttcggg gaaaaaagag        60
     cttcttatcc ttactcatac ccatccggat cccgatgcca ttgctgctgc ggttgccttg       120
     cgcctccttc ttaaggaatt atttcatgtc ggtgcaagca ttgcctacag cggaattatc       180
     gccagggcag aaaatcgggc catggtgaag aaactcaatc ttccccttaa gcagtacagc       240
     cgaatcaaac tttcacgtta cgacggaatt gctctcgtgg attcccagcc aggtgcgggc       300
     aacaatgtgc ttgatgcttc atctccgtgt gatatcgtca tcgaccacca tccccgtcgg       360
     gatgatacca aaggtgcctt tgttgtgatc gaaccggaac ttggggcttc tgccacgatg       420
     cttatcgaat ggcttgatgc cgctggagta gatctgtcgg ccgatatcgc cacagcactt       480
     gcctatgcca taagttctga gacccagaat atgtatcggg aggccgcccg cagagatatt       540
     cgggcctatc tatcggtcta tgtacgggcc agcatcagaa agttggccgg aattatcaat       600
     gccaacttgc ctcattacta ttttcttcag cttggagatg caatcaataa tgcccttatg       660
     ttcggcacaa tgattacgac gcacctggac gaaattcgtc accctgagat tgttgccgag       720
     atggctgatt ttcttcttaa gcatgagcgg atagggacgg ttcttgtttc agggcgtttt       780
     cggaaccatc taatcatctc gattcgcact cgtagtgagg ggattaatgc cggcagactg       840
     atcaagcaat taccgcttga ccctgataat gttggagggc atgatcgaac cgccggaggc       900
     ttcttcgatc ttcacggcaa ggatcgaaaa gaggttgagg agattaatat caccatacgc       960
     aacgcctttg ccgctcttct cggttatgag aacccctcat ggcggaagct ccttgatcag      1020
     gttccacgta aaagctga                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page