(data stored in ACNUC7421 zone)

EMBL: CP002116.PE241

CP002116.PE241       Location/Qualifiers
FT   CDS_pept        complement(250896..251363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0244"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR008254; KEGG: mac:MA2078 flavodoxin;
FT                   SPTR: Flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79401"
FT                   /db_xref="GOA:E1RAB0"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAB0"
FT                   /protein_id="ADK79401.1"
FT                   /translation="MVKKILIAYSSYFGNCKKAASTLAASCDEEGMETSLYPILESETL
FT                   PEKPDILVLVTPVRVRKIVGPSKKFLRKIGEKDLRYALVVSHGAALDHFFSPVPATKKL
FT                   ERHLERKEMVRITEPLFLQVERQQGPLSKGYEKRLADLAKQLSQAVSEEDR"
     atggtgaaga aaattttaat tgcatatagt tcctatttcg ggaactgcaa gaaagcggca        60
     tccacccttg ccgcaagttg tgacgaggaa ggcatggaga caagccttta tcccattctt       120
     gaatcggaaa ccctcccgga aaaaccagat atcctcgtcc ttgtaacgcc tgtcagggta       180
     cggaagattg tcgggccaag caagaaattt ctccgaaaga tcggagaaaa agatctccgt       240
     tatgccctgg tcgtaagtca cggtgcggct ctggaccact ttttctcccc ggttccagcg       300
     acaaagaaac tggaacggca cttggaacgc aaggaaatgg ttcgaattac cgagcctctc       360
     ttcctgcagg tagagagaca gcaaggcccc ttatcgaagg gttatgaaaa acgcctagca       420
     gatcttgcaa agcagttgag ccaggccgtt tcagaggaag acagataa                    468
//

If you have problems or comments...

PBIL Back to PBIL home page