(data stored in ACNUC7421 zone)

EMBL: CP002116.PE242

CP002116.PE242       Location/Qualifiers
FT   CDS_pept        complement(251906..252343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0246"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fnu:FN1201 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79402"
FT                   /db_xref="GOA:E1RAB1"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAB1"
FT                   /protein_id="ADK79402.1"
FT                   /translation="MKKVDDSNIMEGLEEKREEIIREINEYNRERDQIRAMLGKIGGKS
FT                   YSKTDMIINIVFLTIILLLFILELTTHFLPAFISLEVSVLLVSIKIVWMIHSQHRFNHF
FT                   QFWVLNSIEFRINNMHKMVRGMEKELKQLREDKHNTNAVGP"
     atgaaaaaag ttgatgacag caatattatg gaaggtcttg aggaaaaacg tgaagagatt        60
     atacgtgaga ttaacgaata caaccgggaa cgagaccaaa ttcgcgcaat gttgggaaaa       120
     atcggcggaa aaagttactc aaagaccgac atgattatca atattgtctt tctaaccatt       180
     attttattgc tttttattct cgaactaacg acacactttc taccggcttt catatccctg       240
     gaagtcagtg ttcttctggt ttcgattaag attgtctgga tgatccacag ccagcatcga       300
     ttcaatcact tccagttttg ggttctcaac tcgatcgaat ttcgtatcaa taatatgcat       360
     aagatggtca gaggaatgga aaaagagcta aaacagcttc gggaggataa acacaacaca       420
     aatgccgtgg gaccatga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page